MKISDAVVSAHIDDEVVLLHLQTGTYFGLDAVGSRIWSLLEEGKRPEEIVDAICAEYSVDRPTVERDLRDFLRALANKEL
LEGYAD
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5v1v:A | 88 | 86 | 1.0000 | 0.9773 | 1.0000 | 4.73e-59 | 5v1u:A, 5v1u:B, 5v1u:C, 5v1u:D, 5v1v:B |
2 | 6jx3:B | 85 | 66 | 0.2326 | 0.2353 | 0.3030 | 2.56e-04 | |
3 | 6fdz:U | 265 | 53 | 0.1977 | 0.0642 | 0.3208 | 0.80 | 6fdy:U |
4 | 6u0o:B | 288 | 26 | 0.1395 | 0.0417 | 0.4615 | 1.4 | |
5 | 3t37:A | 509 | 39 | 0.1395 | 0.0236 | 0.3077 | 1.7 | 4ha6:A |
6 | 1g7s:A | 576 | 88 | 0.2907 | 0.0434 | 0.2841 | 1.8 | 1g7t:A |
7 | 6oko:A | 263 | 50 | 0.1860 | 0.0608 | 0.3200 | 2.7 | 6oko:B |
8 | 6or5:A | 2058 | 50 | 0.1512 | 0.0063 | 0.2600 | 2.9 | |
9 | 1gvr:A | 364 | 14 | 0.1047 | 0.0247 | 0.6429 | 3.0 | 2aba:A, 2abb:A, 3f03:K, 6gi7:A, 6gi8:A, 6gi9:A, 6gia:A, 1gvo:A, 1gvq:A, 1gvs:A, 1h50:A, 1h51:A, 1h60:A, 1h61:A, 1h62:A, 1h63:A, 3kft:A, 3kft:B, 5lgx:A, 5lgz:A, 3p62:A, 3p67:A, 3p74:A, 3p7y:A, 3p80:A, 3p81:A, 3p82:A, 3p84:A, 3p8i:A, 3p8j:A, 1vyp:X, 1vyr:A, 1vys:X |
10 | 1xag:A | 353 | 27 | 0.1744 | 0.0425 | 0.5556 | 3.8 | 1xah:A, 1xah:B, 1xai:A, 1xai:B, 1xaj:A, 1xaj:B, 1xal:A, 1xal:B |
11 | 4m69:A | 287 | 35 | 0.1512 | 0.0453 | 0.3714 | 4.1 | |
12 | 3gfy:B | 374 | 34 | 0.1512 | 0.0348 | 0.3824 | 5.6 | 3gfy:A |
13 | 4lmb:A | 310 | 29 | 0.1395 | 0.0387 | 0.4138 | 6.4 |