BioLiP

>protein
MKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRLRERWD

The query sequence (length=51) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5kc1:F	61	51	1.0000	0.8361	1.0000	9.80e-31	5kc1:D, 5kc1:B, 5kc1:L, 5kc1:J
2	1q4s:A	142	37	0.2941	0.1056	0.4054	0.11	1q4s:B, 1q4t:A, 1q4t:B, 1q4u:A, 1q4u:B, 3r32:A, 3r32:B, 3r34:A, 3r34:B, 3r35:A, 3r35:B, 3r37:A, 3r37:B, 3r3a:A, 3r3a:B, 3r3b:A, 3r3b:B, 3r3c:A, 3r3c:B, 3r3d:A, 3r3d:B, 3r3f:A, 3r3f:B, 3tea:A, 3tea:B
3	6fah:E	393	43	0.3529	0.0458	0.4186	0.85	6fah:A
4	3fxr:A	296	20	0.1765	0.0304	0.4500	1.1	3fxu:A, 3fxu:B, 3n6u:A
5	8pz4:A	466	31	0.1765	0.0193	0.2903	1.2	7acg:A, 4afk:A, 4azl:A, 4azl:B, 4b61:A, 4b61:B, 8q2o:A, 3rbh:A, 3rbh:B, 8rqp:A, 4xnk:A, 4xnl:A
6	3rbh:D	410	31	0.1765	0.0220	0.2903	1.3	3rbh:C
7	8c29:R	219	28	0.2549	0.0594	0.4643	2.0	8c29:r
8	6ax8:A	509	36	0.2745	0.0275	0.3889	2.5	5xet:C
9	9ax8:z	509	37	0.2353	0.0236	0.3243	2.7	3jcj:f, 3jcn:b, 5me0:W, 5me1:W, 6o7k:f, 6o9k:z
10	6fli:A	310	27	0.2549	0.0419	0.4815	3.9	6fli:B, 6fli:C, 6fli:D, 6fli:E, 6fvs:D
11	1czq:A	45	27	0.2157	0.2444	0.4074	6.8	1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B
12	7wfg:K	167	21	0.2353	0.0719	0.5714	7.7	7wg5:K
13	6mve:A	680	22	0.1765	0.0132	0.4091	7.9	6cgl:A, 6cgl:B, 6cgn:A, 6mt9:A, 6mv9:A, 6mv9:B, 6mw3:D, 6mw3:C, 6myx:C, 6myx:D, 6myx:I, 6myx:J
14	5frb:A	470	28	0.1961	0.0213	0.3571	8.6	6cr2:A, 6cr2:B, 4uyl:A, 4uyl:B, 4uym:A, 4uym:B

[Back]