MKICKACSSCMVRTYVDGNIIFRCSCGESVQGDSQNLLVSSKVYHTGEMEDKYKIFIKNAPFDPTNCQIKKDCPNCHLDY
LTQICIGSQKIIILVCRCGYMSNRG
The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8q3b:I | 105 | 105 | 1.0000 | 1.0000 | 1.0000 | 6.36e-75 | 8q3k:I |
2 | 1z2n:X | 311 | 44 | 0.0952 | 0.0322 | 0.2273 | 2.6 | 1z2o:X, 1z2p:X |
3 | 2y4e:A | 384 | 45 | 0.1524 | 0.0417 | 0.3556 | 3.4 | 3o72:A, 3o72:B, 3o72:C, 3o72:D, 2y4e:B, 2y4f:A, 2y4f:B |
4 | 5zeb:4 | 50 | 22 | 0.1143 | 0.2400 | 0.5455 | 6.6 | 8kab:c, 5o60:c, 5o61:c, 7s0s:d, 8v9j:5, 8v9k:5, 8v9l:5, 8whx:6, 8why:6, 8wi7:6, 8wi8:6, 8wib:6, 8wic:6, 7xam:c, 8xz3:c, 7y41:c, 5zep:1, 5zet:4 |
5 | 5eyw:A | 244 | 28 | 0.0952 | 0.0410 | 0.3571 | 6.6 | 5eyw:B |
6 | 5swi:B | 693 | 64 | 0.1810 | 0.0274 | 0.2969 | 7.3 | 5swi:A, 5swi:C, 5swi:D |
7 | 7msc:1 | 49 | 22 | 0.1048 | 0.2245 | 0.5000 | 7.6 | 7f0d:1, 7kgb:1, 7msh:1, 7msm:1, 7msz:1, 7mt2:1, 7mt3:1, 7mt7:1, 7sfr:1, 5v7q:1, 5v93:1 |