MKGYTVPLSPRGIANLAPAPPWHYAGTVVGVEFFTDPAAAAATLPEGLTPDPDSAGRGVAMFIDWQYSSTGLEYLDPARS
QYREFLITLDAHCNGAPVAWCPYIYVDNDAAMARGWVQGFPKKLGAVHQTRAYSVGGPGTPVLGPGGQFGATASSAGQRI
AEAKITLEQPVPDPAALMSRPVINLRHFPRLAAGQHDQPAVHELVMSVLDDTAVSDAWVGTADLAFLPAHGEELADLPVR
RTGKGFHFDLAFTVTDLMTLADHS
The query sequence (length=264) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6eej:A | 264 | 264 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6eej:B, 6eej:C, 6eej:D, 4zbt:A, 4zbt:B, 4zbt:C, 4zbt:D |
2 | 4jmd:B | 262 | 263 | 0.3864 | 0.3893 | 0.3878 | 1.17e-50 | 4jmc:A, 4jmc:B, 4jmd:A, 4jme:A, 4jme:B |
3 | 7ane:ad | 694 | 59 | 0.0833 | 0.0317 | 0.3729 | 0.31 | |
4 | 7aor:ad | 801 | 109 | 0.1288 | 0.0424 | 0.3119 | 0.34 | |
5 | 1ss9:A | 280 | 29 | 0.0530 | 0.0500 | 0.4828 | 0.39 | 1g9r:A, 1ga8:A |
6 | 3bh3:D | 245 | 250 | 0.2386 | 0.2571 | 0.2520 | 0.52 | 3bh3:A, 3bh3:B, 3bh3:C |
7 | 2iuj:A | 833 | 54 | 0.0720 | 0.0228 | 0.3519 | 0.98 | |
8 | 6hiv:DD | 791 | 59 | 0.0833 | 0.0278 | 0.3729 | 1.1 | 6hiw:DD, 6hiy:DD, 7pua:DD, 7pub:DD, 6sga:DD, 6sgb:DD |
9 | 6eqo:A | 1804 | 57 | 0.0568 | 0.0083 | 0.2632 | 5.1 | 6eqo:B |
10 | 2xrc:B | 485 | 29 | 0.0455 | 0.0247 | 0.4138 | 6.4 | 5o32:D, 5o32:H, 2xrc:A, 2xrc:D |
11 | 2xrc:C | 454 | 29 | 0.0455 | 0.0264 | 0.4138 | 7.0 | |
12 | 7dsn:A | 471 | 84 | 0.0833 | 0.0467 | 0.2619 | 7.1 | 2dh3:A, 6jmq:B |
13 | 8an2:AAA | 1040 | 190 | 0.1780 | 0.0452 | 0.2474 | 7.4 | 8an3:AAA, 7zcx:AAA |
14 | 5zi5:A | 850 | 73 | 0.0644 | 0.0200 | 0.2329 | 9.1 | 5zi5:B, 5zi7:A, 5zi7:B, 5zie:A, 5zie:B |