BioLiP

>protein
MKGIIFNVLEDMVVAQCGMSVWNELLEKHAPKDRVYVSAKSYAESELFSIVQDVAQRLNMPIQDVVKAFGQFLFNGLASR
HTDVVDKFDDFTSLVMGIHDVIHLEVNKLYHEPSLPHINGQLLPNNQIALRYSSPRRLCFCAEGLLFGAAQHFAAAIQIS
HDTCMHTGADHCMLIIELQNDENLYFQ

The query sequence (length=187) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4u99:A	187	187	1.0000	1.0000	1.0000	2.63e-141	2kii:A, 2kil:A, 4u99:B, 4u9b:A, 4u9g:A, 4u9g:B, 4u9j:A, 4u9j:B, 4u9k:A, 4u9k:B
2	6ocv:A	190	190	0.3155	0.3105	0.3105	1.88e-23	6wqe:A
3	6bdd:A	185	188	0.2460	0.2486	0.2447	2.32e-17	6bde:A
4	6dxi:A	189	189	0.2246	0.2222	0.2222	1.38e-11	4iae:A, 4iae:B, 4iah:A, 4iah:B, 4iam:A, 4iam:B, 5ixr:A, 5ixr:B, 5ixv:A, 5ixv:B, 5ixw:A, 5ixw:B, 5ixx:A, 5ixx:B, 5ixz:A, 5ixz:B, 4jqh:A, 4jqh:B, 3l6j:A, 3l6j:B, 7lgk:A, 7lgk:B, 6mx5:A, 2o09:A, 2o09:B, 2o0c:A, 2o0c:B, 2o0g:A, 2o0g:B, 3tf8:A, 3tf8:B, 3tf9:A, 3tf9:B, 3tfa:A, 3tfa:B, 3tfd:A, 3tfd:B, 3tfe:A, 3tfe:B, 3tff:A, 3tff:B, 3tfg:A, 3tfg:B
5	8hbh:B	577	75	0.0909	0.0295	0.2267	0.24	7d9r:B, 7d9s:B, 7d9t:B, 7d9u:B, 8hbe:B, 8hbf:B, 6jt0:B, 6jt1:B, 6jt2:B, 5mnw:A
6	6oxd:A	736	53	0.0802	0.0204	0.2830	1.3	6oxc:A
7	4ooz:A	368	84	0.1176	0.0598	0.2619	4.1	4ooz:B
8	6hyj:B	223	28	0.0695	0.0583	0.4643	5.8	6hyj:A, 6hyy:A, 6hyy:B, 1l8l:A, 1l8l:B, 1l8o:A, 1l8o:B, 1nnl:A, 1nnl:B, 6q6j:A, 6q6j:B
9	3cke:D	284	35	0.0588	0.0387	0.3143	9.5
10	1u02:A	229	56	0.0963	0.0786	0.3214	9.9

[Back]