BioLiP

>protein
MKAFEFLYEDFQRGLTVVLDKGLPPKFVEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKDWGIKVYPGGTLFEY
AYSKGKFDEFLNECEKLGFEAVEISDGSSDISLEERNNAIKRAKDNGFMVLTEVGKKMPDKDKQLTIDDRIKLINFDLDA
GADYVIIEGRESGKGKGLFDKEGKVKENELDVLAKNVDINKVIFEAPQKSQQVAFILKFGSSVNLANIAFDEVISLETLR
RGLRGDTFGKV

The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1qwg:A	251	251	1.0000	1.0000	1.0000	0.0
2	2hk1:A	289	75	0.0916	0.0796	0.3067	0.020	2hk1:B, 2hk1:C, 2hk1:D
3	6imc:D	340	101	0.0876	0.0647	0.2178	0.076	6imc:A, 6imc:B, 6imc:C, 6ksf:A, 6l94:A
4	2p1r:A	290	73	0.0717	0.0621	0.2466	0.38	2p1r:B, 2p1r:C, 2p1r:D
5	7jid:A	287	70	0.0876	0.0767	0.3143	2.4	7jid:B
6	7ehq:A	406	64	0.0797	0.0493	0.3125	2.6	7ehu:A
7	4q5n:A	220	72	0.0956	0.1091	0.3333	4.2	4q5n:B
8	1xc4:A	240	49	0.0677	0.0708	0.3469	4.5	1xc4:B
9	5mcp:F	342	110	0.1235	0.0906	0.2818	5.0
10	4hea:1	437	87	0.0916	0.0526	0.2644	5.6	2fug:1, 2fug:A, 2fug:J, 2fug:S, 4hea:B, 6i0d:1, 6i0d:B, 6i1p:1, 6i1p:B, 3i9v:1, 3i9v:A, 3iam:1, 3iam:A, 3ias:1, 3ias:A, 3ias:J, 3ias:S, 3m9s:1, 3m9s:A, 6q8o:1, 6q8o:B, 6q8w:1, 6q8w:B, 6q8x:1, 6q8x:B, 6y11:1, 6y11:B, 2ybb:1, 6ziy:1, 6zjl:1, 6zjn:1, 6zjy:1
11	7fa1:A	276	85	0.0956	0.0870	0.2824	7.2
12	4q4k:A	351	23	0.0438	0.0313	0.4783	7.9	4q4k:B, 4qis:A, 4qis:B, 4qit:A, 4qit:B, 4qiu:A, 4qiu:B
13	2gg6:A	445	52	0.0598	0.0337	0.2885	9.1	2gga:A, 2ggd:A, 2pqb:A, 2pqc:A, 2pqd:A
14	1zt2:A	327	31	0.0478	0.0367	0.3871	9.1	5of3:A, 5of3:D, 5ofn:A, 1zt2:C
15	7t2r:B	425	45	0.0558	0.0329	0.3111	9.9	7t2r:G, 7t30:B, 7t30:G

[Back]