MIVDFYFDFLSPFSYLANQRLSKLAQDYGLTIRYNAIDLARVKIAIGNVGPSNRDLKVKLDYLKVDLQRWAQLYGIPLVF
PANYNSRRMNIGFYYSGAEAQAAAYVNVVFNAVWGEGIAPDLESLPALVSEKLGWDRSAFEHFLSSNAATERYDEQTHAA
IERKVFGVPTMFLGDEMWWGNDRLFMLESAMGRLCRQNADLSS
The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2imd:A | 203 | 203 | 1.0000 | 1.0000 | 1.0000 | 5.66e-152 | 2ime:A, 2imf:A |
2 | 3fz5:C | 192 | 189 | 0.2365 | 0.2500 | 0.2540 | 1.35e-09 | 3fz5:A, 3fz5:B |
3 | 1r4w:A | 221 | 209 | 0.2217 | 0.2036 | 0.2153 | 1.57e-06 | 1r4w:B, 1r4w:C, 1r4w:D |
4 | 3rpn:A | 220 | 208 | 0.2217 | 0.2045 | 0.2163 | 0.012 | 3rpn:B, 3rpn:C, 3rpn:F, 3rpn:D, 3rpn:E, 1yzx:A, 1yzx:B |
5 | 8btd:Lh | 116 | 74 | 0.1034 | 0.1810 | 0.2838 | 0.21 | 8br8:Lh, 8brm:Lh, 8bsi:Lh, 8bsj:Lh, 8btr:Lh, 8fru:g, 7pwg:g, 7pwo:g2 |
6 | 7ane:ag | 557 | 31 | 0.0640 | 0.0233 | 0.4194 | 0.75 | |
7 | 3fig:B | 577 | 42 | 0.0985 | 0.0347 | 0.4762 | 1.2 | 3fig:A, 3hps:A, 3hps:B, 3hpz:A, 3hpz:B, 3hq1:A, 3hq1:B, 1sr9:A, 1sr9:B, 3u6w:A, 3u6w:B |
8 | 3oeh:Y | 201 | 44 | 0.0936 | 0.0945 | 0.4318 | 3.3 | 3fks:Y, 2hld:Y, 3oe7:Y, 3oee:Y |
9 | 4n83:A | 285 | 33 | 0.0591 | 0.0421 | 0.3636 | 3.9 | 4n83:B, 4n83:C, 4n83:D, 4n83:E, 4n83:F, 4n83:G, 4n83:H |
10 | 7pua:DH | 568 | 31 | 0.0542 | 0.0194 | 0.3548 | 5.0 | 6hiv:DH, 6hiw:DH, 6hiz:DH, 7pub:DH |