MITVFGLKSKLAPRREKLAEVIYNSLHLGLDIPKGKHAIRFLCLEKEDFYYPFDRSDDYTVIEINLMAGRMEGTKKRLIK
MLFSELEYKLGIRAHDVEITIKEQPAHCWGFRGMTGDEAR
The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1mww:C | 120 | 120 | 1.0000 | 1.0000 | 1.0000 | 2.67e-87 | |
2 | 4lho:A | 131 | 106 | 0.2583 | 0.2366 | 0.2925 | 7.22e-06 | 4lho:B, 4lho:C, 4lho:D, 4lho:E, 3mlc:A, 3mlc:B, 3mlc:C, 3mlc:D, 3mlc:E |
3 | 7ms8:A | 146 | 92 | 0.1917 | 0.1575 | 0.2500 | 0.007 | 7ms1:A, 7ms3:A, 7ms9:A, 7ms9:B, 7ms9:H, 7ms9:I, 7ms9:K |
4 | 207l:A | 130 | 47 | 0.1250 | 0.1154 | 0.3191 | 1.7 | 208l:A, 1d6q:A, 1hnl:A, 1i22:A, 1i22:B, 1i22:C, 1i22:D, 3lhm:A, 5lsh:A, 1re2:A, 1rem:A, 1rez:A, 1ubz:A |
5 | 4pfy:A | 539 | 106 | 0.2167 | 0.0482 | 0.2453 | 2.0 | 4pft:A, 4pft:B, 4pfy:B |
6 | 7vpp:A | 904 | 32 | 0.1083 | 0.0144 | 0.4062 | 4.2 | 6buy:A, 6bv0:A, 6bv1:A, 6bv2:A, 6bv3:A, 6bv4:A, 4f5c:A, 4f5c:B, 4fke:A, 4fkh:A, 4fkk:A, 4hom:A, 5lds:D, 5lds:A, 5lds:B, 5lds:C, 5lg6:A, 5lg6:B, 4naq:A, 4nz8:A, 4ou3:A, 7vpp:C, 5z65:A |
7 | 5lug:A | 207 | 58 | 0.1083 | 0.0628 | 0.2241 | 9.3 | 5lug:D, 5lug:C, 5lug:B |