MITRGEFFMIKEMYERGMSISDIARELGIDRKTVRKYIHSPNPPSKSKRKQRKSKLDPFKPYLQKRMLEDGVFNSEKLFF
EIRQQGYTGGKTILKDYMKPFRETAKKKYTVRYETLPGEQMQVDWKEVGEVVIEGKKVKLSLFVATLGYSRMKYAVFTTS
QDQEHLMECLIQSFKYFGGVPKKVLFDNMKTVTDGREQGVVKWNQRFSEFASYYGFIPKVCRPYRAQTKGKVERAIQYIM
DHFYVGTAFESIEELNFLLHRWLDQVANRKPNATTGISPQERWAEESLKPLPLKDYDTSYLSYRKVHWDGSFSYKGEQWL
LSAEYAGKEILVKERLNGDIRLYFRGEEISHV
The query sequence (length=352) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8q4d:D | 373 | 352 | 1.0000 | 0.9437 | 1.0000 | 0.0 | 8b4h:A, 8b4h:B, 8b4h:C, 8b4h:D, 8q4d:A, 8q4d:B, 8q4d:C |
2 | 7ut1:b | 244 | 144 | 0.0966 | 0.1393 | 0.2361 | 0.046 | 7usf:D, 7usf:C, 7ut1:g, 7ut1:h, 7ut1:H, 7ut1:f, 7ut1:B, 7ut1:F, 7ut1:G |
3 | 7usf:A | 265 | 122 | 0.0909 | 0.1208 | 0.2623 | 0.16 | 5cz2:A, 5cz2:B, 5cz2:C, 5cz2:D, 5cz2:E, 5cz2:G, 5cz2:H, 5cz2:I, 5cz2:J, 5cz2:K, 5cz2:L, 3jca:A, 3jca:D, 3jca:E, 3jca:G, 3jca:C, 3jca:H, 3jca:B, 3jca:F, 7usf:B, 7ut1:a, 7ut1:d, 7ut1:e, 7ut1:A, 7ut1:D, 7ut1:E, 7ut1:C |
4 | 6wqp:B | 354 | 194 | 0.1080 | 0.1073 | 0.1959 | 0.66 | 6wqv:A, 6wqv:B, 6wqv:C, 6wqv:D |
5 | 2r0q:C | 193 | 31 | 0.0398 | 0.0725 | 0.4516 | 1.2 | 2r0q:D, 2r0q:E, 2r0q:F |
6 | 7qv9:M | 417 | 40 | 0.0483 | 0.0408 | 0.4250 | 1.8 | 8f1i:M, 8f1j:M, 8f1k:M, 7qwp:M, 7qxi:M, 8re4:M, 8rea:M |
7 | 5v8c:A | 272 | 27 | 0.0312 | 0.0404 | 0.4074 | 1.9 | |
8 | 8reb:M | 350 | 40 | 0.0483 | 0.0486 | 0.4250 | 2.0 | 8rec:M, 8red:M, 8ree:M |
9 | 6gh6:M | 315 | 40 | 0.0483 | 0.0540 | 0.4250 | 2.4 | |
10 | 5nss:M | 388 | 40 | 0.0483 | 0.0438 | 0.4250 | 3.0 | 6gfw:M, 6gh5:M, 5nsr:M |
11 | 5d6j:A | 630 | 49 | 0.0483 | 0.0270 | 0.3469 | 4.2 | 5ey8:A, 5ey8:B, 5ey8:C, 5ey8:D, 5ey8:E, 5ey8:F, 5ey8:G, 5ey8:H, 5icr:A, 5icr:B, 5icr:C, 5icr:D |
12 | 6dv9:F | 174 | 31 | 0.0369 | 0.0747 | 0.4194 | 5.7 | 6dvb:F, 6dvc:F, 6dvd:F, 6dve:F, 7rwi:F, 6tye:F, 6tyf:F |
13 | 2fts:A | 419 | 36 | 0.0341 | 0.0286 | 0.3333 | 7.0 | 5err:A, 5ers:A, 5ert:A, 5eru:A, 5erv:A, 6fgc:A, 6fgd:A, 6hsn:A, 6hso:A, 4pd1:A, 1t3e:B, 4tk1:A, 4tk1:B, 4tk2:B, 4tk2:A, 4tk3:B, 4tk3:A, 4tk4:B, 4tk4:A, 4u90:A, 4u91:A |
14 | 6n9l:A | 625 | 28 | 0.0341 | 0.0192 | 0.4286 | 7.9 | |
15 | 2c1z:A | 439 | 38 | 0.0369 | 0.0296 | 0.3421 | 8.0 | 2c1x:A, 2c9z:A |
16 | 5i44:B | 68 | 29 | 0.0284 | 0.1471 | 0.3448 | 8.9 | 5i44:A, 5i44:D, 5i44:E, 5i44:H, 5i44:J, 5i44:K, 5i44:G, 5i44:F, 5i44:I |
17 | 3pih:A | 836 | 28 | 0.0341 | 0.0144 | 0.4286 | 9.3 |