MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYM
TDVMPANPDNSPVSSELQEVFYLP
The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1x8d:A | 104 | 104 | 1.0000 | 1.0000 | 1.0000 | 7.02e-76 | 1x8d:B, 1x8d:C, 1x8d:D |
2 | 2qlw:B | 108 | 102 | 0.4038 | 0.3889 | 0.4118 | 6.27e-28 | 2qlx:A, 2qlx:B |
3 | 7byw:A | 108 | 112 | 0.2981 | 0.2870 | 0.2768 | 8.85e-09 | 7byw:B |
4 | 2rc9:A | 287 | 96 | 0.2692 | 0.0976 | 0.2917 | 0.99 | 2rc7:A, 2rc7:B, 2rc8:A, 2rc8:B, 2rc9:B |
5 | 6slr:B | 81 | 32 | 0.1250 | 0.1605 | 0.4062 | 3.3 | 6slr:C, 4v2o:B, 4v2o:C |
6 | 6ej7:A | 706 | 55 | 0.1731 | 0.0255 | 0.3273 | 3.3 | 6ej8:A, 6ej9:A, 6eja:A, 6ejb:A, 6ejc:A, 6ejd:A, 6eje:A |
7 | 7b9q:A | 868 | 44 | 0.1058 | 0.0127 | 0.2500 | 4.3 | 7b9q:B |
8 | 7b9p:A | 899 | 44 | 0.1058 | 0.0122 | 0.2500 | 4.3 | |
9 | 4s17:A | 452 | 51 | 0.1538 | 0.0354 | 0.3137 | 6.2 | 4s17:B, 4s17:C, 4s17:D, 4s17:E, 4s17:F |
10 | 4a05:A | 360 | 28 | 0.0962 | 0.0278 | 0.3571 | 6.7 | |
11 | 5csl:A | 2050 | 36 | 0.1250 | 0.0063 | 0.3611 | 7.0 | |
12 | 5uid:A | 367 | 21 | 0.0865 | 0.0245 | 0.4286 | 7.2 | 5uid:D |
13 | 5ee3:B | 364 | 25 | 0.0769 | 0.0220 | 0.3200 | 8.0 | 5ee3:A, 5ee9:A |
14 | 1tuv:A | 103 | 40 | 0.1346 | 0.1359 | 0.3500 | 9.3 | |
15 | 2ozg:A | 388 | 47 | 0.1442 | 0.0387 | 0.3191 | 9.4 |