MINWQVIGQLMSTAVIMLAGPAVIVLLALKKGNL
The query sequence (length=34) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6j3z:y | 34 | 34 | 1.0000 | 1.0000 | 1.0000 | 3.24e-17 | 6j3z:Y, 6j40:y, 6j40:Y, 7vd5:y |
| 2 | 8xlp:y | 32 | 32 | 0.5000 | 0.5312 | 0.5312 | 4.97e-07 | 8xlp:Y |
| 3 | 8wb4:Y | 34 | 34 | 0.4118 | 0.4118 | 0.4118 | 6.80e-05 | 8wb4:y, 8xr6:Y, 8xr6:y |
| 4 | 6dhe:y | 30 | 30 | 0.4706 | 0.5333 | 0.5333 | 1.88e-04 | 8gn0:Y, 8gn1:Y, 4il6:y, 7yq2:Y, 7yq2:y, 7yq7:y |
| 5 | 3ojc:A | 230 | 26 | 0.3824 | 0.0565 | 0.5000 | 2.9 | 3ojc:B |
umich.edu