MHHHHHHAMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1hz5:A | 72 | 72 | 1.0000 | 1.0000 | 1.0000 | 7.84e-49 | 1hz5:B, 1jml:A, 1k51:A, 1k52:A, 1k52:B, 1k53:A, 1k53:B |
2 | 5tvg:A | 468 | 52 | 0.2083 | 0.0321 | 0.2885 | 0.51 | 5tvg:B, 5tvg:C, 5tvg:D, 5tvg:E, 5tvg:F, 5tvg:G, 5tvg:H, 5uof:B |
3 | 3rss:A | 494 | 14 | 0.1111 | 0.0162 | 0.5714 | 5.5 | 2ax3:A, 3rrb:A, 3rre:A, 3rrf:A, 3rrj:A, 3rs8:A, 3rs9:A, 3rsf:A, 3rsg:A, 3rsq:A, 3rt7:A, 3rt9:A, 3rta:A, 3rtb:A, 3rtc:A, 3rtd:A, 3rte:A, 3rtg:A, 3ru2:A, 3ru3:A |
4 | 1h76:A | 677 | 52 | 0.2222 | 0.0236 | 0.3077 | 5.9 | |
5 | 6fvt:L | 388 | 33 | 0.1667 | 0.0309 | 0.3636 | 7.7 | 6ef0:L, 6ef1:L, 6ef2:L, 6ef3:L, 6fvu:L, 6fvv:L, 6fvw:L, 6fvx:L, 6fvy:L, 5mp9:L, 5mpa:L, 5mpb:L, 5mpc:L, 7qo4:L, 7qo5:L, 7qo6:L |
6 | 7w02:A | 1566 | 36 | 0.1806 | 0.0083 | 0.3611 | 8.8 | |
7 | 2c44:C | 468 | 31 | 0.2083 | 0.0321 | 0.4839 | 10.0 | 2c44:A, 2c44:D, 2c44:B, 5d8g:A |