MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEV
PAFG
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3vyy:A | 86 | 84 | 1.0000 | 0.9767 | 1.0000 | 6.00e-60 | 3vyy:B |
2 | 5ztm:A | 168 | 81 | 0.5476 | 0.2738 | 0.5679 | 8.31e-32 | 5ztm:B |
3 | 3adi:A | 71 | 59 | 0.2262 | 0.2676 | 0.3220 | 0.011 | |
4 | 8dga:K | 182 | 68 | 0.2024 | 0.0934 | 0.2500 | 0.015 | 8dg7:K |
5 | 6sdw:A | 177 | 58 | 0.2381 | 0.1130 | 0.3448 | 0.021 | 6htu:A, 6htu:B, 6htu:C, 6sdy:A |
6 | 8dfv:K | 253 | 60 | 0.1905 | 0.0632 | 0.2667 | 0.094 | 8dg5:K |
7 | 9asp:C | 92 | 58 | 0.2143 | 0.1957 | 0.3103 | 0.35 | |
8 | 6v5b:C | 217 | 68 | 0.2500 | 0.0968 | 0.3088 | 0.93 | 6v5b:B, 6v5c:C, 6v5c:B |
9 | 9asp:B | 250 | 70 | 0.2500 | 0.0840 | 0.3000 | 1.8 | 9asm:B, 9asn:B, 9asq:B |
10 | 8dh6:a | 534 | 36 | 0.1548 | 0.0243 | 0.3611 | 2.5 | 8e7s:K, 8e7s:k, 8ec0:K, 6giq:a, 6hu9:a, 6hu9:m, 6t0b:a, 6t0b:n, 6t15:a, 6ymx:a, 6ymy:a, 7z10:a |
11 | 4okd:A | 801 | 35 | 0.1667 | 0.0175 | 0.4000 | 4.5 | 4okd:B |
12 | 4g6z:A | 380 | 24 | 0.0952 | 0.0211 | 0.3333 | 5.7 | |
13 | 6tvk:AAA | 660 | 22 | 0.1190 | 0.0152 | 0.4545 | 5.8 | |
14 | 3x1l:B | 319 | 33 | 0.1310 | 0.0345 | 0.3333 | 6.5 | |
15 | 7aoi:AF | 442 | 38 | 0.1310 | 0.0249 | 0.2895 | 7.4 | 6hiv:AF, 6hix:AF, 6yxy:AF |
16 | 5dv7:C | 137 | 31 | 0.1310 | 0.0803 | 0.3548 | 9.5 |