MFQPLLDAYVESASIEKMASKSPPPLKIAVANWWGDEEIKEFKNSVLYFILSQRYTITLHQNPNEFSDLVFGNPLGSARK
ILSYQNAKRVFYTGENESPNFNLFDYAIGFDELDFNDRYLRMPLYYDRLHHKAESVNDTTAPYKLKDNSLYALKKPSHCF
KEKHPNLCAVVNDESDPLKRGFASFVASNPNAPIRNAFYDALNSIEPVTGGGSVRNTLGYNVKNKNEFLSQYKFNLCFEN
TQGYGYVTEKIIDAYFSHTIPIYWGSPSVAKDFNPKSFVNVHDFKNFDEAIDYIKYLHTHKNAYLDMLYENPLNTLDGKA
YFYQNLSFKKILAFFKTILENDTIYHDNPFI
The query sequence (length=351) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2nzy:C | 351 | 351 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2nzx:A, 2nzx:B, 2nzx:C, 2nzy:A, 2nzy:B, 5zoi:A, 5zoi:B |
2 | 8d0w:A | 298 | 135 | 0.1225 | 0.1443 | 0.3185 | 2.11e-05 | 8d0q:A, 8d0r:A, 8d0s:A, 8d0u:A, 8d0x:A |
3 | 5yvg:B | 764 | 130 | 0.0969 | 0.0445 | 0.2615 | 0.52 | |
4 | 5yvg:A | 830 | 154 | 0.1111 | 0.0470 | 0.2532 | 0.72 | 2h4m:B, 2ot8:B, 5yvh:A |
5 | 8sgh:A | 844 | 130 | 0.0969 | 0.0403 | 0.2615 | 0.81 | 7cyl:A, 4fdd:A, 4fq3:A, 2h4m:A, 5j3v:A, 5j3v:B, 4jlq:A, 4oo6:A, 2ot8:A, 5tqc:A, 7vpw:A, 5yvi:A, 2z5k:A, 2z5m:A, 2z5n:A, 2z5o:A |
6 | 1dgj:A | 906 | 131 | 0.0855 | 0.0331 | 0.2290 | 1.3 | |
7 | 4x95:B | 377 | 75 | 0.0484 | 0.0451 | 0.2267 | 5.5 | 6mtw:A, 6mtw:B, 4x91:A, 4x91:B, 4x91:C, 4x91:D, 4x95:A, 4x97:A, 4x97:B, 4x97:C, 4x97:D |
8 | 4g6h:A | 472 | 32 | 0.0399 | 0.0297 | 0.4375 | 6.4 | 4g6g:A, 4g6g:B, 4g6h:B, 4g73:A, 4g73:B, 4g74:A, 4g74:B, 4g9k:A, 4g9k:B, 4gap:A, 4gap:B, 4gav:A, 4gav:B |
9 | 5yjy:B | 465 | 32 | 0.0399 | 0.0301 | 0.4375 | 6.9 | 5yjw:A, 5yjx:A, 5yjx:B, 5yjy:A |
10 | 6dql:A | 227 | 46 | 0.0484 | 0.0749 | 0.3696 | 7.1 |