BioLiP

>protein
MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDAKMRRAGLDYHEYAQMRVHRDWDAFVAAEAPDPARMFAF
TTRGSGRFHDRAFEPGDWFVFGAETRGLAPALVDRFAPEQRVRLPMRPGNRSLNLSNTVAVVVFEAWRQAGFEGGA

The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4kgn:C	157	156	1.0000	0.9936	1.0000	1.94e-113	4kgn:E, 4kgn:G
2	4kgn:A	139	156	0.8910	1.0000	0.8910	4.76e-95
3	3n4k:A	163	158	0.5513	0.5276	0.5443	6.57e-64
4	4jal:A	156	154	0.5513	0.5513	0.5584	8.63e-63	4jal:B
5	1mxi:A	156	156	0.5321	0.5321	0.5321	5.86e-62
6	7e3q:B	159	155	0.5385	0.5283	0.5419	5.48e-58
7	5co4:B	161	149	0.4295	0.4161	0.4497	1.97e-36	5co4:A
8	4pzk:A	159	155	0.4295	0.4214	0.4323	5.17e-35	4pzk:B
9	8w9u:A	152	154	0.3846	0.3947	0.3896	4.35e-26	8w9u:B
10	4x3l:A	260	73	0.1731	0.1038	0.3699	3.38e-05	4x3l:B, 4x3m:A, 4x3m:B
11	7oi6:1	257	146	0.2372	0.1440	0.2534	2.90e-04	7oi6:z
12	1v2x:A	191	154	0.2692	0.2199	0.2727	4.51e-04
13	4cng:A	156	157	0.2436	0.2436	0.2420	0.006	4cnf:A, 4cng:B
14	5gm8:B	173	169	0.3077	0.2775	0.2840	0.12	5gm8:A, 5gm8:C, 5gm8:D
15	7ki9:A	166	103	0.1987	0.1867	0.3010	0.47	8f80:A, 8f81:A, 8f82:A, 8f83:A, 8f84:A, 8f85:A, 7k68:A, 7k69:A, 7k6a:A, 7ki8:A, 7km7:A, 7km8:A, 7km8:B, 7km9:A, 8ta0:A, 8ta1:A, 8tbr:A, 6uwq:A, 6uww:A
16	7edc:A	236	156	0.2372	0.1568	0.2372	0.61
17	6h5l:B	220	66	0.1026	0.0727	0.2424	2.1
18	6lsr:3	255	41	0.0833	0.0510	0.3171	2.5	6lqm:3, 6lu8:3
19	4gn7:A	297	74	0.1474	0.0774	0.3108	3.3	4gn7:B, 4gn8:A, 4gn8:B, 4gn9:A, 4gn9:B, 4gna:A, 4gna:B
20	8yla:A	328	85	0.1667	0.0793	0.3059	7.3	8yla:B
21	7am2:BU	463	103	0.1923	0.0648	0.2913	7.4
22	6h9s:B	292	83	0.1218	0.0651	0.2289	9.4	6h9s:A

[Back]