MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTR
NVYVTEVLADTVRFMDP
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3vdy:A | 101 | 100 | 0.9897 | 0.9505 | 0.9600 | 2.02e-66 | 3vdy:B |
2 | 7dep:B | 102 | 101 | 0.6082 | 0.5784 | 0.5842 | 6.49e-38 | |
3 | 6bhx:C | 102 | 105 | 0.6186 | 0.5882 | 0.5714 | 2.42e-37 | 6bhx:A, 6bhx:B |
4 | 8gw5:A | 99 | 105 | 0.5464 | 0.5354 | 0.5048 | 1.50e-31 | 7ym1:A |
5 | 3a5u:A | 118 | 81 | 0.3814 | 0.3136 | 0.4568 | 1.48e-16 | 3a5u:B |
6 | 2vw9:A | 108 | 108 | 0.4227 | 0.3796 | 0.3796 | 7.68e-16 | 2vw9:B |
7 | 3udg:C | 214 | 76 | 0.2990 | 0.1355 | 0.3816 | 1.32e-14 | 3udg:B, 3udg:A |
8 | 3udg:C | 214 | 31 | 0.1649 | 0.0748 | 0.5161 | 7.56e-04 | 3udg:B, 3udg:A |
9 | 1eqq:B | 120 | 99 | 0.3814 | 0.3083 | 0.3737 | 4.66e-14 | 1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D |
10 | 5odp:G | 100 | 96 | 0.3505 | 0.3400 | 0.3542 | 1.07e-13 | 5odp:A |
11 | 5odn:D | 106 | 101 | 0.3505 | 0.3208 | 0.3366 | 6.68e-12 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
12 | 6irq:C | 104 | 94 | 0.3299 | 0.3077 | 0.3404 | 1.58e-09 | 6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D |
13 | 6rup:A | 111 | 105 | 0.2887 | 0.2523 | 0.2667 | 1.23e-04 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
14 | 3ulp:C | 116 | 83 | 0.2371 | 0.1983 | 0.2771 | 1.31e-04 | 3ulp:A, 3ulp:B, 3ulp:D |
15 | 8uzt:B | 100 | 96 | 0.2680 | 0.2600 | 0.2708 | 1.44e-04 | |
16 | 7mq9:LM | 2005 | 44 | 0.1443 | 0.0070 | 0.3182 | 1.5 | |
17 | 7mqa:LM | 2041 | 44 | 0.1443 | 0.0069 | 0.3182 | 1.5 | |
18 | 7dpt:A | 556 | 34 | 0.1443 | 0.0252 | 0.4118 | 2.8 | 7dpt:B, 7dpt:C, 7dpt:D, 7dpw:A, 7dpw:B, 7dpw:C, 7dpw:D, 8i0h:A, 8i0i:A, 8i0i:C, 8i0i:D, 8i0i:E, 7wiz:A, 7wiz:B, 7wiz:C, 7wiz:D, 7wj4:D, 7wj4:A, 7wj4:B, 7wj4:C |
19 | 6td7:A | 126 | 48 | 0.1237 | 0.0952 | 0.2500 | 3.6 | |
20 | 8wi0:A | 1220 | 45 | 0.1649 | 0.0131 | 0.3556 | 3.9 | 8kci:A, 8wi2:A, 8wi5:A |
21 | 2wta:A | 212 | 29 | 0.1134 | 0.0519 | 0.3793 | 5.1 | 2wt9:A, 2wt9:B |
22 | 2uyy:A | 292 | 21 | 0.0928 | 0.0308 | 0.4286 | 6.0 | 2uyy:D |
23 | 4m1e:B | 273 | 38 | 0.1340 | 0.0476 | 0.3421 | 6.4 | 4m1e:A, 4m1e:F, 4m1e:E, 4m1e:C, 4m1e:D |
24 | 1b25:A | 611 | 34 | 0.1134 | 0.0180 | 0.3235 | 7.6 | 1b25:B, 1b25:C, 1b25:D, 1b4n:A, 1b4n:B, 1b4n:C, 1b4n:D |