BioLiP

>protein
MEVNDLGFVASILFVLVPSVFLLILYIQTQSREGKE

The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8wql:MD	36	36	1.0000	1.0000	1.0000	6.45e-20	8wql:ME, 8wql:M1, 8wql:m1, 8wql:mD, 8wql:mE
2	3a0b:M	36	33	0.6667	0.6667	0.7273	1.27e-12	3a0b:m, 3a0h:M, 3a0h:m, 5b66:M, 7d1u:M, 7d1u:m, 7dxh:m, 8f4f:m, 6jln:M, 6jlo:M, 6jlp:M, 5mx2:m, 1s5l:M, 1s5l:m, 5tis:M, 5v2c:M
3	8tow:M	31	29	0.6667	0.7742	0.8276	1.54e-11	8tow:m
4	5xnl:M	33	33	0.5278	0.5758	0.5758	1.07e-08	7oui:M, 7oui:m, 5xnl:m, 5xnm:M, 5xnm:m
5	7ymi:M	31	30	0.5278	0.6129	0.6333	1.82e-08	7ymi:m, 7ymm:1M, 7ymm:2M, 7ymm:3M, 7ymm:4M
6	8bd3:m	57	32	0.5000	0.3158	0.5625	6.65e-08
7	7pi5:M	32	32	0.4722	0.5312	0.5312	2.28e-07	7pi5:m, 7pin:M, 7pin:m, 7pin:M1, 7pin:m1, 7piw:M, 7piw:m, 7piw:M1, 7piw:m1, 7pnk:M, 7pnk:m
8	6kac:M	30	29	0.4167	0.5000	0.5172	3.01e-05	6kac:m, 6kad:M, 6kad:m
9	4yuu:m2	40	32	0.4444	0.4000	0.5000	1.13e-04	4yuu:m1, 4yuu:M2
10	8wb4:M	36	35	0.4167	0.4167	0.4286	3.35e-04	8wb4:m
11	7y5e:ML	42	33	0.3889	0.3333	0.4242	0.002	7y5e:m6, 7y7a:M9, 7y7a:ME, 7y7a:mO, 7y7a:mZ, 7y7a:Mm
12	8xlp:m	38	35	0.3333	0.3158	0.3429	0.014
13	8j5k:M	41	32	0.3333	0.2927	0.3750	0.068	8j5k:m

[Back]