BioLiP

>protein
METLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGND
QVSATLTVT

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5jdj:B	91	89	1.0000	0.9780	1.0000	3.92e-62	5jdj:E, 5jdj:I, 5jdj:L, 4qeg:A
2	1waa:C	93	88	0.3034	0.2903	0.3068	3.75e-07	1waa:A, 1waa:B, 1waa:D, 1waa:E, 1waa:F
3	6h4l:A	96	89	0.3258	0.3021	0.3258	7.46e-04
4	6s9f:B	300	83	0.2247	0.0667	0.2410	0.85	6s9f:A
5	3pps:A	564	31	0.1573	0.0248	0.4516	1.2	3pps:B, 3pps:C, 3pps:D
6	1dyq:A	228	47	0.1910	0.0746	0.3617	1.8	1i4g:A, 1i4h:A, 1i4h:B, 1sxt:A, 1sxt:B
7	7ysw:C	213	33	0.1685	0.0704	0.4545	1.9	7ysw:E
8	5oyj:A	161	48	0.1573	0.0870	0.2917	1.9	5oyj:B
9	2kny:A	80	20	0.1011	0.1125	0.4500	2.3	2knx:A
10	7za1:E	251	58	0.2135	0.0757	0.3276	3.1	7za1:F, 7za1:H, 7za2:E, 7za2:G, 7za3:E, 7za3:G
11	3fu7:A	559	22	0.1236	0.0197	0.5000	3.4	3dkh:A, 3dkh:B, 3fu7:B, 3fu8:A, 3fu8:B, 3fu9:A, 3fu9:B, 1gw0:A, 1gw0:B, 2ih8:A, 2ih8:B, 2ih9:A, 2ih9:B, 2q9o:A, 2q9o:B, 3qpk:A, 3qpk:B
12	6tu9:A	267	67	0.2022	0.0674	0.2687	3.5	6tu9:B
13	7ok5:A	582	68	0.2584	0.0395	0.3382	6.1	7ok5:B
14	3p6b:A	186	50	0.1573	0.0753	0.2800	6.1	3p6b:B
15	1djs:A	206	20	0.1124	0.0485	0.5000	6.4	3cu1:C, 3cu1:A, 1e0o:B
16	7ysh:D	213	33	0.1685	0.0704	0.4545	7.0	1fq9:C, 1fq9:D, 7ysh:E
17	3ia8:A	162	33	0.1124	0.0617	0.3030	7.1	3ia8:B
18	5ijl:A	943	26	0.1236	0.0117	0.4231	7.3
19	8ppt:B	1191	26	0.1236	0.0092	0.4231	7.3	8ppu:B, 8ppv:B, 6t8h:B

[Back]