BioLiP

>protein
METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNE
FAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDY
ITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWEERAQRLFSTK
GKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEPYWLYKL
HGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEY
EDSSGNVVNKKTYEDLKRQGLL

The query sequence (length=422) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i0p:w	434	434	1.0000	0.9724	0.9724	0.0	7abh:4, 7abi:4, 7evo:C, 8hk1:C, 8i0r:w, 8i0s:w, 8i0t:w, 8i0u:w, 7onb:N, 7q3l:9, 7q4o:9, 7q4p:9, 6qx9:A3, 8r08:9, 8rm5:9, 7vpx:C, 6y50:9
2	6ff7:9	432	458	0.9313	0.9097	0.8581	0.0
3	6ah0:w	443	482	0.9028	0.8600	0.7905	0.0	6ahd:w, 8ch6:J, 8h6e:2F, 8h6j:2F, 8h6k:2F, 8h6l:2F, 7qtt:J, 5z56:w, 5z57:w, 5z58:w
4	6g90:T	462	326	0.2275	0.2078	0.2945	1.96e-35	7dco:u, 4dgw:A, 5nrl:T, 5zwm:u
5	2pmp:A	160	132	0.0758	0.2000	0.2424	0.008
6	7ane:d	343	50	0.0427	0.0525	0.3600	0.14
7	5w8o:B	346	76	0.0569	0.0694	0.3158	1.2	5w8o:A
8	8hi7:B	295	44	0.0355	0.0508	0.3409	2.0	8hi8:B
9	3emr:A	279	108	0.0521	0.0789	0.2037	3.3
10	6ul2:A	526	26	0.0213	0.0171	0.3462	5.1	8tti:A, 8tti:B, 8tti:C, 8tti:D, 8ttj:A, 8ttj:B, 8ttj:C, 8ttj:D, 6ul2:B, 6ul2:C, 6ul2:D
11	7qv3:w	593	98	0.0664	0.0472	0.2857	6.0

[Back]