MESYLVDTYQGIPYTAAVQVDLIEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQNGPILKVNASAQGAA
MSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESES
ATVEAAIALTQAKIAPYAGLIMIMTMNNPKGGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR
The query sequence (length=229) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4lp7:D | 230 | 230 | 1.0000 | 0.9957 | 0.9957 | 1.41e-168 | 4lp7:A, 4lp7:B, 4lp7:C |
2 | 7ovc:A | 167 | 149 | 0.1528 | 0.2096 | 0.2349 | 2.7 | 7nw1:AAA, 7nw1:BBB |
3 | 3u44:A | 1122 | 123 | 0.1266 | 0.0258 | 0.2358 | 4.6 | 3u4q:A |
4 | 8bos:G | 320 | 57 | 0.0830 | 0.0594 | 0.3333 | 4.7 | 1wq1:G |
5 | 6q2n:E | 553 | 144 | 0.1528 | 0.0633 | 0.2431 | 4.7 | 6q2n:F |
6 | 6q2o:E | 572 | 147 | 0.1528 | 0.0612 | 0.2381 | 5.0 | 6q2j:E, 6q2j:F, 6q2o:F, 6q2r:E, 6q2r:F, 6q2r:Y, 6q2r:Z, 6q2s:E, 6q2s:F, 4ux8:A, 4ux8:B |
7 | 6uxw:A | 778 | 103 | 0.1266 | 0.0373 | 0.2816 | 9.6 | 7egp:A, 6iy2:O, 6iy3:O, 6uxv:A, 5x0x:O, 5x0y:O, 5z3l:O, 5z3o:O, 5z3u:O, 5z3v:O |