MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASL
HRVLGSWTGDSVNYAASRFLGANQVGCHYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTP
The query sequence (length=146) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6bjv:A | 148 | 148 | 0.9863 | 0.9730 | 0.9730 | 1.96e-104 | 6bjg:A, 6bjg:B, 6bjh:A, 6bjh:B, 6bjv:B, 4j39:A, 4j5v:A, 4jgn:A, 4jk0:D, 4jnx:A, 4jnx:D, 4knq:A, 4kq0:A, 4kq0:D, 4ktg:A, 1r9f:A, 1rpu:A, 1rpu:B |
2 | 6d97:A | 522 | 34 | 0.0959 | 0.0268 | 0.4118 | 0.031 | 6d97:B, 6d97:C, 6d97:D |
3 | 5jcs:r | 333 | 88 | 0.1438 | 0.0631 | 0.2386 | 1.1 | |
4 | 6hnd:B | 470 | 31 | 0.0822 | 0.0255 | 0.3871 | 2.4 | 6hnd:A, 6hnv:A, 6hnv:B |
5 | 1e5q:A | 449 | 13 | 0.0616 | 0.0200 | 0.6923 | 5.8 | 1e5q:B, 1e5q:C, 1e5q:D, 1e5q:E, 1e5q:F, 1e5q:G, 1e5q:H |
6 | 5ta1:A | 627 | 44 | 0.0959 | 0.0223 | 0.3182 | 6.5 | 5ta0:A, 5ta0:B, 5ta5:A, 5ta5:B |
7 | 1uzr:B | 288 | 38 | 0.0890 | 0.0451 | 0.3421 | 7.3 | 1uzr:A, 1uzr:C |
8 | 3rdk:B | 334 | 37 | 0.0890 | 0.0389 | 0.3514 | 8.9 | 4e4p:A, 4e4p:B, 3rdk:A, 3ro8:A, 3ro8:B, 3ro8:C, 3ro8:D, 3ro8:E, 3ro8:F, 3ro8:G, 3ro8:H |