MENFPTEYFLNTTVRLLEYIRYRDSNYTREERIENLHYAYNKAAHHFAQPRQQQLLKVDPKRLQASLQTIVGMVVYSWAK
VSKECMADLSIHYTYTLVLEDSKDDPYPTMVNYFDDLQAGREQAHPWWALVNEHFPNVLRHFGPFCSLNLIRSTLDFFEG
CWIEQYNFGGFPGSHDYPQFLRRMNGLGHCVGASLWPKEQFNERSLFLEITSAIAQMENWMVWVNDLMSFYKEFDDERDQ
ISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAVFSDKDPQVMDTIECFMHGYVTWHLCDRRYRLSEIYEKVKEEKTE
DAQKFCKFYEQAANVGAVSPSEWAYPPVAQLANV
The query sequence (length=354) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2aek:A | 354 | 354 | 0.9944 | 0.9944 | 0.9944 | 0.0 | 2aek:B, 2ael:B, 2aet:B, 1jfg:B, 1kiz:B, 2ps4:A, 2ps4:B, 2ps5:B, 2ps7:A, 2ps7:B, 2ps8:B, 2q9y:B, 2q9z:B, 1yyq:B, 1yyr:A, 1yyr:B, 1yys:A, 1yys:B, 1yyt:A, 1yyt:B, 1yyu:A, 1yyu:B |
2 | 8h4p:A | 326 | 164 | 0.1186 | 0.1288 | 0.2561 | 9.52e-08 | 8h4p:B |
3 | 1qlm:A | 316 | 87 | 0.0650 | 0.0728 | 0.2644 | 0.19 | |
4 | 3auy:A | 366 | 90 | 0.0706 | 0.0683 | 0.2778 | 0.29 | 3aux:A, 3auy:B, 3av0:B, 5dny:D, 5dny:B, 5f3w:D, 5f3w:B |
5 | 7kv7:BBB | 258 | 34 | 0.0339 | 0.0465 | 0.3529 | 2.9 | 7kv6:AAA, 7kv7:AAA |
6 | 7y9g:A | 344 | 54 | 0.0395 | 0.0407 | 0.2593 | 6.3 | |
7 | 4okm:A | 346 | 168 | 0.1045 | 0.1069 | 0.2202 | 6.9 | 4okm:B, 4okm:C, 4okz:A, 4okz:B, 4okz:C, 4okz:D |
8 | 7y9g:B | 311 | 54 | 0.0395 | 0.0450 | 0.2593 | 7.0 | |
9 | 1e3d:B | 537 | 67 | 0.0508 | 0.0335 | 0.2687 | 7.8 | 1e3d:D |
10 | 8btg:B | 335 | 61 | 0.0452 | 0.0478 | 0.2623 | 9.2 | 8btg:A, 8btg:C, 8btg:D, 8btg:E, 8btg:F, 8btg:G, 8bv3:A, 8bv3:B, 8bv3:C, 8bv3:D, 8bv3:E |
11 | 6i3d:B | 218 | 36 | 0.0282 | 0.0459 | 0.2778 | 9.2 | 3a7e:A, 3bwm:A, 3bwy:A, 6i3c:A, 6i3d:A, 5lsa:A, 4pyj:A, 4pyk:A, 4xuc:A, 4xud:A, 4xue:B, 4xue:A |