BioLiP

>protein
MELYNIKYAIDPTNKIVIEQVDNVDAFVHILEPGQEVFDETLSQYHQFPGVVSSIIFPQLVLNTIISVLSEDGSLLTLKL
ENTCFNFHVCNKRFVFGNLPAAVVNNETKQKLRIGAPIFAGKKLVSVVTAFHRVGENEWLLPVTGIREASQLSGHMKVLN
GVRVEKWRPNMSVYGTVQLPYDKIKQHALEQENNALESCVLFYKDSEIRITYNKGDYEIMHLRMPGPLI

The query sequence (length=229) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6xb3:A	234	232	1.0000	0.9786	0.9871	6.20e-171	6xb3:B, 6xb3:C, 6xb3:D, 6xb3:E, 6xb3:F, 6xb3:G, 6xb3:H, 6xb3:I, 6xb3:J, 6xb3:K, 6xb3:L, 6xb3:M, 6xb3:N, 6xb3:O, 6xb3:P
2	6ea8:A	195	163	0.2052	0.2410	0.2883	0.006	6ea8:B, 6ea8:E, 6ea8:F, 6ea8:G, 6ea8:H, 6ea9:A, 6ea9:B, 6ea9:C, 6ea9:D, 6ea9:E, 8orv:A, 8p44:A, 8p44:B, 8p44:C, 8p44:D
3	8acc:A	231	52	0.0873	0.0866	0.3846	2.6
4	4eu5:A	513	94	0.1048	0.0468	0.2553	3.9	5ddk:A, 5ddk:B, 5dw4:B, 5dw4:A, 5dw5:A, 5dw5:B, 5dw6:A, 5dw6:B, 5e5h:A, 5e5h:B, 4eu3:B, 4eu4:A, 4eu4:B, 4eu5:B, 4eu6:A, 4eu6:B, 4eu7:A, 4eu7:B, 4eu8:A, 4eu8:B, 4eu9:A, 4eu9:B, 4eua:A, 4eua:B, 4eub:A, 4eub:B, 4euc:A, 4euc:B, 4eud:A, 4eud:B
5	6xyw:Ac	218	83	0.0873	0.0917	0.2410	5.6
6	6bhn:A	156	55	0.0655	0.0962	0.2727	6.5	6bho:A
7	3w2z:A	178	30	0.0480	0.0618	0.3667	6.9	5zoh:A
8	6c9h:B	168	70	0.0786	0.1071	0.2571	7.4	6e4t:B, 6e4u:B, 6e4w:B, 5kq5:B, 4qfr:B, 4qfs:B, 5t5t:B, 5ufu:B
9	6vfr:A	428	64	0.0961	0.0514	0.3438	8.7	6vfr:B
10	2okj:B	504	68	0.0742	0.0337	0.2500	9.4	2okj:A, 3vp6:A, 3vp6:B

[Back]