BioLiP

>protein
MEKENLIIAGKIGPEPEILANMYKLLIEENTSMTATVKPNFGTTSFLYEALKKGDIDIYPEFTGTVTESLLQPSPKVSHE
PEQVYQVARDGIAKQDHLAYLKPMSYQNTYAVAVPKKIAQEYGLKTISDLKKVEGQLKAGFTLEFNDREDGNKGLQSMYG
LNLNVATMQPALRYQAIHSGDIQITDAYSTDAELERYDLQVLEDDKQLFPPYQGAPLMKEALLKKHPELERVLNTLAGKI
TESQMSQLNYQVGVEGKSAKQVAKEFLQEQVC

The query sequence (length=272) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7txl:A	275	270	0.9926	0.9818	1.0000	0.0	7txk:A, 7txk:B, 7txl:B
2	7s7x:A	278	273	0.3787	0.3705	0.3773	1.41e-60	7s7x:B, 7s7x:C, 6v1r:A
3	3ppo:A	272	260	0.3603	0.3603	0.3769	1.54e-50	3ppo:B, 3ppq:A, 3ppq:B, 3ppr:A, 3ppr:B
4	7s7t:A	509	197	0.2941	0.1572	0.4061	5.54e-48	8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
5	7s7t:A	509	77	0.1029	0.0550	0.3636	0.001	8i4o:A, 8i4o:C, 8i4o:E, 8i4o:G, 8i4o:I, 8i4o:K
6	6eyh:A	280	270	0.3493	0.3393	0.3519	1.85e-47	6eyl:A, 6eyl:B, 5nxy:A, 5nxy:C, 3r6u:A
7	1sw1:A	270	268	0.3529	0.3556	0.3582	4.28e-47	1sw1:B, 1sw4:A, 1sw4:B
8	8dp7:A	265	270	0.3419	0.3509	0.3444	2.48e-43	8dp7:B, 8dp7:C, 8dp7:D, 8dp7:E
9	2pie:A	132	56	0.0662	0.1364	0.3214	2.5
10	5wcn:M	382	147	0.1250	0.0890	0.2313	4.3	5wcn:A, 5wd7:A
11	4o7p:B	451	50	0.0625	0.0377	0.3400	5.4
12	1f5o:A	149	40	0.0404	0.0738	0.2750	7.6	1f5o:B, 1f5o:C, 1f5o:D, 1f5o:E, 1f5o:F, 1f5p:A, 1f5p:B, 1f5p:C, 1f5p:D, 1f5p:E, 1f5p:F, 2lhb:A, 3lhb:A, 3lhb:B, 3lhb:C, 3lhb:D, 3lhb:E, 3lhb:F, 3lhb:G, 3lhb:H, 3lhb:I, 3lhb:J, 3lhb:K, 3lhb:L, 1uc3:A, 1uc3:B, 1uc3:C, 1uc3:D, 1uc3:E, 1uc3:F, 1uc3:G, 1uc3:H, 1uc3:I, 1uc3:J, 1uc3:K, 1uc3:L
13	7en7:A	191	49	0.0588	0.0838	0.3265	8.5	7en5:A, 7en6:D

[Back]