MEIRKKLVVPSKYGTKCPYTMKPKYITVHNTYNDAPAENEVNYMITNNNEVSFHVAVDDKQAIQGIPWERNAWACGDGNG
PGNRESISVEICYSKSGGDRYYKAENNAVDVVRQLMSMYNIPIENVRTHQSWSGKYCPHRMLAEGRWGAFIQKVKSG
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2l47:A | 165 | 157 | 0.9299 | 0.8848 | 0.9299 | 4.06e-111 | 2ar3:A, 2ar3:B, 2ar3:C, 1yb0:A, 1yb0:B, 1yb0:C |
2 | 3hmb:B | 156 | 146 | 0.3822 | 0.3846 | 0.4110 | 2.72e-31 | 3hmb:A, 3hmb:C, 3rdr:A |
3 | 4knk:B | 208 | 101 | 0.1847 | 0.1394 | 0.2871 | 1.19e-04 | 4knk:A, 4knl:C, 4knl:D |
4 | 8c4d:A | 184 | 133 | 0.2357 | 0.2011 | 0.2782 | 1.36e-04 | |
5 | 4ols:A | 185 | 140 | 0.2166 | 0.1838 | 0.2429 | 0.001 | 4ols:B, 4ols:C, 4ols:D |
6 | 3jb9:c | 300 | 41 | 0.1019 | 0.0533 | 0.3902 | 0.51 | |
7 | 6fih:A | 379 | 50 | 0.0892 | 0.0369 | 0.2800 | 1.0 | |
8 | 3r7d:A | 291 | 41 | 0.0955 | 0.0515 | 0.3659 | 2.7 | 3r7d:C, 3r7d:B, 3r7f:A, 3r7f:B, 3r7f:C, 3r7l:A, 3r7l:B, 3r7l:C, 3r7l:D, 3r7l:E, 3r7l:F |
9 | 6fiy:B | 303 | 67 | 0.1338 | 0.0693 | 0.3134 | 3.7 | 6fiy:A, 6fks:A, 6fks:B, 6fkt:A, 6fkt:B, 6fl2:A, 6fl2:B, 6rpd:A, 6rpd:B, 6rpe:A, 6rpe:B, 6rqy:A, 6rqy:B, 6rr1:A, 6rr1:B, 6rr4:A, 6rr4:B, 6rr5:A, 6rr5:B, 6rr6:A, 6rr6:B, 6rr8:A, 6rr8:B |
10 | 3ik2:A | 512 | 64 | 0.1210 | 0.0371 | 0.2969 | 6.1 |