MEHLYIVSYDIRNQRRWRRLFKTMHGFGCWLQLSVFQCRLDRIRIIKMEAAINEIVNHAEDHVLILDLGPAENVKPKVSS
IGKTFDPILRQ
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7mi4:E | 95 | 91 | 1.0000 | 0.9579 | 1.0000 | 1.56e-65 | 7mi4:F, 7mi5:E, 7mi5:F, 7mi9:E, 7mi9:F, 7mib:F, 7mib:E, 7mid:C, 7mid:D |
2 | 7cr8:M | 93 | 66 | 0.2527 | 0.2473 | 0.3485 | 1.02e-08 | 7cr6:E, 7cr6:F, 7cr8:N, 7cr8:U, 7cr8:V, 7cr8:e, 7cr8:f, 7cr8:m, 7cr8:n, 7cr8:u, 7cr8:v, 7cr8:E, 7cr8:F |
3 | 6p55:B | 327 | 27 | 0.1429 | 0.0398 | 0.4815 | 0.070 | 6p52:A, 6p53:B, 6p54:A, 6p54:B, 6p55:A, 6xqv:A, 6xqv:B |
4 | 8veq:A | 325 | 27 | 0.1319 | 0.0369 | 0.4444 | 0.22 | 6vbd:A, 8ven:A, 8vep:A |
5 | 6m9g:A | 280 | 40 | 0.1209 | 0.0393 | 0.2750 | 1.4 | 6eg7:A, 6eg7:B, 6m9g:B |
6 | 7ook:C | 373 | 31 | 0.1429 | 0.0349 | 0.4194 | 3.5 | 7ook:B, 7ook:A |
7 | 2j0f:A | 446 | 73 | 0.2198 | 0.0448 | 0.2740 | 4.3 | 2j0f:B, 2j0f:C, 1uou:A, 2wk6:A, 2wk6:B |
8 | 1v26:B | 510 | 30 | 0.1538 | 0.0275 | 0.4667 | 4.6 | 1v25:A, 1v25:B, 1v26:A |
9 | 4cej:A | 1177 | 40 | 0.1429 | 0.0110 | 0.3250 | 6.2 | 4ceh:A, 4cei:A |
10 | 7s6u:A | 351 | 63 | 0.1978 | 0.0513 | 0.2857 | 6.7 | 7s6v:A |