MEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNAPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3e6z:X | 80 | 80 | 1.0000 | 1.0000 | 1.0000 | 9.31e-55 | 2qcp:X, 2vb2:X |
2 | 8c2q:A | 100 | 76 | 0.5250 | 0.4200 | 0.5526 | 2.34e-23 | 8bbz:CCC |
3 | 8bwv:B | 80 | 77 | 0.5125 | 0.5125 | 0.5325 | 1.41e-21 | 8bwv:A, 8bwv:C, 8bwv:D, 8bwv:E, 8bwv:F |
4 | 6mg0:B | 1687 | 41 | 0.1875 | 0.0089 | 0.3659 | 0.41 | |
5 | 6mfz:A | 1789 | 41 | 0.1875 | 0.0084 | 0.3659 | 0.43 | 5es7:A, 5es8:A, 5es8:B, 5es9:A, 6mfw:A, 6mfx:A, 6mfy:A, 6mg0:A, 6ulz:A |
6 | 8fmw:AI | 148 | 27 | 0.1250 | 0.0676 | 0.3704 | 0.79 | 8fn2:I |
7 | 8ayh:B | 951 | 26 | 0.1500 | 0.0126 | 0.4615 | 3.1 | 3frp:A, 3hrz:A, 3hs0:A, 3hs0:F |
8 | 2g42:B | 78 | 32 | 0.1250 | 0.1282 | 0.3125 | 7.1 | |
9 | 6skz:A | 2638 | 60 | 0.2000 | 0.0061 | 0.2667 | 7.7 | 6sl0:A, 6sl0:B |
10 | 6sl1:A | 2652 | 60 | 0.2000 | 0.0060 | 0.2667 | 7.7 | 6sky:A, 6sky:B |
11 | 8qre:A | 237 | 35 | 0.1500 | 0.0506 | 0.3429 | 9.4 | 2a5f:B |