MDRPFIFINSAMSADGKLSTKERKQVKISGKLDFERMDELRAHADAIMVGIGTVLADDPSLTVKSPERKAARKAAGKSEN
PVRVVVDSSARTPLNADIFKKGEGLRIIAVSNSAPEEKIRMLEEKALVIKTGAFRVDLTELAAKLKEMGINSLMVEGGAT
LNWGMLSAGLVDEVYTFVGNLIIGGKTAPTFTDGEGFTENELLGLELSSAEKIEDGILLKWKVK
The query sequence (length=224) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5xv0:F | 239 | 224 | 0.9955 | 0.9331 | 0.9955 | 2.47e-161 | 5xux:A, 5xux:B, 5xux:C, 5xux:D, 5xux:E, 5xux:F, 5xv0:A, 5xv0:B, 5xv0:C, 5xv0:D, 5xv0:E, 5xv2:A |
2 | 6p8c:A | 216 | 223 | 0.4509 | 0.4676 | 0.4529 | 1.29e-56 | 6p8c:B |
3 | 2azn:A | 219 | 227 | 0.4688 | 0.4795 | 0.4626 | 3.72e-55 | 2azn:B, 2azn:C, 2azn:D, 2azn:E, 2azn:F |
4 | 4g3m:A | 361 | 195 | 0.2589 | 0.1607 | 0.2974 | 2.22e-20 | 2b3z:A, 2b3z:B, 2b3z:C, 2b3z:D, 2d5n:A, 2d5n:B, 2d5n:C, 2d5n:D, 3ex8:A, 3ex8:B, 3ex8:C, 3ex8:D, 4g3m:B, 4g3m:C, 4g3m:D |
5 | 8dqb:A | 370 | 216 | 0.3036 | 0.1838 | 0.3148 | 1.35e-19 | 8dq9:A, 8dq9:B, 8dqc:A, 8dqc:B |
6 | 2o7p:A | 358 | 187 | 0.2679 | 0.1676 | 0.3209 | 1.96e-18 | 2o7p:B, 2obc:A |
7 | 3zpc:A | 357 | 192 | 0.2277 | 0.1429 | 0.2656 | 1.71e-13 | 3zpc:B, 3zpg:A |
8 | 4ha9:A | 219 | 188 | 0.2411 | 0.2466 | 0.2872 | 1.48e-11 | |
9 | 2hxv:A | 349 | 183 | 0.2500 | 0.1605 | 0.3060 | 2.60e-11 | |
10 | 6de5:A | 246 | 149 | 0.1786 | 0.1626 | 0.2685 | 9.63e-08 | 4xrb:A, 4xt4:A, 4xt5:A, 4xt6:A, 4xt7:A, 4xt8:A |
11 | 7w0j:E | 382 | 53 | 0.0848 | 0.0497 | 0.3585 | 0.57 | 8i4p:A, 8i4r:A, 7w0j:B, 7w0j:C, 7w0j:H |
12 | 3n1c:A | 309 | 87 | 0.0982 | 0.0712 | 0.2529 | 0.73 | 3cqd:A, 3cqd:B, 3n1c:D, 3n1c:B, 3n1c:C, 3umo:A, 3umo:B, 3ump:A, 3ump:B, 3uqd:A, 3uqd:C, 3uqd:B, 3uqd:D, 3uqe:A, 3uqe:B |
13 | 5ee7:A | 416 | 66 | 0.0938 | 0.0505 | 0.3182 | 1.7 | |
14 | 8dy7:C | 1118 | 67 | 0.1027 | 0.0206 | 0.3433 | 3.6 | 8dy9:C, 8hvr:C, 8jke:C, 8k60:C, 7vpd:C, 7vpz:C, 7x74:C, 7x75:C, 7x76:C |
15 | 1d1g:A | 164 | 55 | 0.0848 | 0.1159 | 0.3455 | 4.5 | 1d1g:B |
16 | 6qfo:A | 1348 | 74 | 0.0982 | 0.0163 | 0.2973 | 4.6 | 8a19:A, 8a1a:A, 6qep:A, 6qev:B, 6qfk:A, 6sh9:B, 2zxq:A |
17 | 7dut:A | 220 | 30 | 0.0580 | 0.0591 | 0.4333 | 4.9 | 7dv3:A, 7dv3:B, 7dwr:A, 7dwr:D, 7dwr:B, 7dwr:C |
18 | 4r1q:E | 496 | 50 | 0.0580 | 0.0262 | 0.2600 | 5.7 | 4r1p:A, 4r1p:B, 4r1p:C, 4r1p:D, 4r1p:E, 4r1p:F, 4r1q:A, 4r1q:D, 4r1q:B, 4r1q:F, 4r1q:C |
19 | 7cyy:C | 497 | 50 | 0.0580 | 0.0262 | 0.2600 | 5.9 | 7cx7:A, 7cx7:B, 7cx7:C, 7cx7:D, 7cx7:E, 7cx7:F, 7cyy:A, 7cyy:B, 7cyy:D, 7cyy:E, 7cyy:F |
20 | 4xco:C | 157 | 51 | 0.0804 | 0.1146 | 0.3529 | 7.7 | |
21 | 6l3h:A | 741 | 35 | 0.0670 | 0.0202 | 0.4286 | 9.0 | 6l3h:B |
22 | 3oa4:A | 138 | 49 | 0.0625 | 0.1014 | 0.2857 | 9.4 |