BioLiP

>protein
MDNLIQPTKTIVDDKGQSIDGKSVLPNSTLTYVAKQDFDQYKGMTAAKESVMKGFIYVDDYKDEAIDGHSLVVNSIKAAN
GDDVTNLLEMRHVLSQDTLDDKLKALIKASGISPVGEFYMWVAKDPAAFYKAYVQKGLDITYNLSFKLKQDFKKGDITNQ
TYQIDFGNGYYGNIVVNHLSELTVHKDVFDKEGGQSINAGTVKVGDEVTYRLEGWVVPTNRGYDLTEYKFVDQLQHTHDL
YQKDKVLATVDITLSDGSVITKGTDLAKYTETVYNKETGHYELAFKQDFLAKVVRSSEFGADAFVVVKRIKAGDVANEYT
LYVNGNPVKSNKVTTHT

The query sequence (length=337) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4ofq:A	337	337	1.0000	1.0000	1.0000	0.0	4ofq:B
2	6e3f:A	497	326	0.3650	0.2475	0.3773	3.61e-60	3opu:A, 3opu:B, 3opu:C, 3opu:D, 3opu:E, 3opu:F, 3qe5:A, 3qe5:B
3	4tsh:B	485	324	0.3412	0.2371	0.3549	2.87e-53
4	7l0o:A	479	323	0.3412	0.2401	0.3560	8.25e-53	7l0o:B, 2woy:A, 2wqs:A, 2wza:A
5	8beg:A	650	339	0.2938	0.1523	0.2920	1.47e-23	8beg:B
6	8beg:A	650	193	0.1721	0.0892	0.3005	3.15e-09	8beg:B
7	8wvd:A	450	49	0.0475	0.0356	0.3265	0.28	6l8z:A
8	7ux7:A	378	126	0.0890	0.0794	0.2381	0.33	7ux6:A, 7ux6:B, 7ux7:B, 7ux8:A, 7ux8:B
9	4g33:A	661	59	0.0504	0.0257	0.2881	0.67	4g32:A, 5ir4:A, 5ir5:A, 5lc8:A, 4rpe:A
10	3oss:D	157	56	0.0534	0.1146	0.3214	1.0
11	5yjg:A	594	68	0.0564	0.0320	0.2794	1.9	5yjh:A
12	1pj6:A	828	75	0.0564	0.0229	0.2533	3.6	3gsi:A, 1pj5:A, 1pj7:A
13	1r9q:A	309	135	0.0979	0.1068	0.2444	5.6

[Back]