MDLFQDKVEAFTGPTMGSTYTVKYVRSGDGPAKEVLHGEVEAILGQLDKQLSTYRSDSDVERFNALPAGSCEPMPDMVRE
LVAAGSQLSADSDGAFDLTLEPLLNLSAEDISAARALTGQQHLSIDGDRLCKAVALQLDFNSIAAGYAVDLVIDRLKALG
VQSYLVEITGELKAEGRKPDGSPWRIAIEAPRDDQRVAQKIVELDGMGVSTSGDYRNYFERYSHTLDPQSGQPIEHHLAA
VTVIDKSTLRADGLSTALMVLGPEKGLALAERNGIAAFFVVREGQGFVTTSTKAFDELFGAGV
The query sequence (length=303) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5mgy:H | 316 | 320 | 0.9868 | 0.9462 | 0.9344 | 0.0 | 5mgy:B, 5mgy:G, 5mgy:A, 5mgy:C, 5mgy:D, 5mgy:F |
2 | 6nxi:A | 309 | 301 | 0.4059 | 0.3981 | 0.4086 | 1.73e-77 | 6nxj:A, 6nxj:B |
3 | 3pnd:C | 323 | 314 | 0.3861 | 0.3622 | 0.3726 | 5.95e-63 | 3pnd:A, 3pnd:B, 3pnd:D |
4 | 2o18:C | 313 | 315 | 0.3663 | 0.3546 | 0.3524 | 4.23e-59 | 2o18:A, 2o18:B, 2o18:D, 4xgv:A, 4xgv:B, 4xgv:C, 4xgv:D, 4xgw:A, 4xgw:B, 4xgw:C, 4xgw:D, 4xgx:B |
5 | 4xgx:A | 290 | 304 | 0.3465 | 0.3621 | 0.3454 | 1.29e-52 | |
6 | 7esa:A | 322 | 261 | 0.2409 | 0.2267 | 0.2797 | 1.06e-26 | 7esb:A, 7esc:A, 7f2u:A, 7f2u:B |
7 | 4ifu:A | 330 | 293 | 0.2970 | 0.2727 | 0.3072 | 2.92e-17 | 4ifw:A, 4ifx:A, 4ifz:A, 4ig1:A, 7mgt:A, 4xdr:A, 4xdt:A, 4xdu:A |
8 | 5awp:A | 596 | 69 | 0.0594 | 0.0302 | 0.2609 | 0.88 | 5awq:A |
9 | 8gjk:C | 1032 | 71 | 0.0528 | 0.0155 | 0.2254 | 3.0 | 8gjl:C, 8gk0:C, 8gk4:C |
10 | 7x2n:A | 340 | 124 | 0.0990 | 0.0882 | 0.2419 | 3.4 | 7x2s:A, 7x2x:A |
11 | 5dnu:A | 267 | 119 | 0.0957 | 0.1086 | 0.2437 | 3.8 | |
12 | 1t7l:A | 734 | 57 | 0.0561 | 0.0232 | 0.2982 | 4.1 | 3bq5:B, 3bq6:A, 3bq6:B, 1t7l:B, 1xdj:A, 1xdj:B, 1xpg:A, 1xpg:B, 1xr2:A, 1xr2:B |
13 | 3el3:A | 417 | 68 | 0.0759 | 0.0552 | 0.3382 | 4.3 | 3el3:B |
14 | 3bq5:A | 709 | 57 | 0.0561 | 0.0240 | 0.2982 | 4.7 | |
15 | 8q9t:A | 1075 | 79 | 0.0825 | 0.0233 | 0.3165 | 4.9 | |
16 | 5mc6:h | 1121 | 79 | 0.0825 | 0.0223 | 0.3165 | 4.9 | 4a4k:A, 4a4k:C, 4a4k:E, 4a4k:G, 4a4k:I |
17 | 5z7w:B | 271 | 50 | 0.0594 | 0.0664 | 0.3600 | 6.1 | 5z7w:A |
18 | 3dbg:A | 379 | 68 | 0.0693 | 0.0554 | 0.3088 | 7.4 | 3dbg:B |
19 | 3gr3:A | 226 | 50 | 0.0462 | 0.0619 | 0.2800 | 9.1 | 3gr3:B |