MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVIS
DTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLI
INDE
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1u3f:A | 164 | 164 | 1.0000 | 1.0000 | 1.0000 | 4.26e-120 | 1u3f:B, 1u3g:A |
2 | 3hy6:A | 198 | 159 | 0.2439 | 0.2020 | 0.2516 | 4.76e-07 | 3hxt:A, 3hy3:A, 3hy4:A |
3 | 2jcb:A | 194 | 185 | 0.3171 | 0.2680 | 0.2811 | 0.003 | 2jcb:B |
4 | 6z1p:Ar | 143 | 91 | 0.1524 | 0.1748 | 0.2747 | 1.5 | |
5 | 8gjh:A | 639 | 33 | 0.0671 | 0.0172 | 0.3333 | 4.5 | 8gjh:B, 8gjh:C, 8gjh:D, 8gjh:E, 8gjh:F |
6 | 8t7m:B | 160 | 41 | 0.0671 | 0.0688 | 0.2683 | 6.9 | 8t7l:A, 8t7l:B, 8t7m:A |