MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGV
ATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEK
WPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3a8g:B | 212 | 211 | 1.0000 | 0.9953 | 1.0000 | 4.15e-156 | 3a8h:B, 3a8m:B, 3a8o:B, 2cz1:B, 2cz6:B, 2d0q:B, 2qdy:B, 3x26:B |
2 | 4ob0:B | 228 | 230 | 0.3318 | 0.3070 | 0.3043 | 1.48e-20 | |
3 | 2dd4:H | 156 | 93 | 0.1185 | 0.1603 | 0.2688 | 0.32 | 2dd4:B, 2dd4:K, 2dd4:E, 2zzd:B, 2zzd:H |
4 | 5jne:A | 351 | 98 | 0.1327 | 0.0798 | 0.2857 | 1.3 | 3i2d:A, 5jne:E |
5 | 4omb:A | 298 | 98 | 0.1185 | 0.0839 | 0.2551 | 4.4 | 4omb:B, 4omb:C, 4omb:D |
6 | 5by6:B | 288 | 53 | 0.0758 | 0.0556 | 0.3019 | 5.1 | 5by6:A, 5by6:C, 5by6:D, 5m4z:A, 5m4z:B |
7 | 6nyy:C | 491 | 60 | 0.0853 | 0.0367 | 0.3000 | 5.6 | 6nyy:B, 6nyy:D, 6nyy:E, 6nyy:A, 6nyy:F |
8 | 4iuh:A | 143 | 20 | 0.0474 | 0.0699 | 0.5000 | 6.4 | 4iuh:B, 4iuk:A, 4iuk:B |
9 | 8jjr:D | 177 | 30 | 0.0664 | 0.0791 | 0.4667 | 7.7 | |
10 | 5nqz:A | 267 | 103 | 0.1232 | 0.0974 | 0.2524 | 8.5 | 5nqz:B |