BioLiP

>protein
MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTKHQTNLA
RRAA

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ch6:I	185	84	1.0000	0.4541	1.0000	8.64e-60	7abi:F, 7onb:M, 7qtt:I, 5z56:v, 5z57:v
2	8i0r:v	173	80	0.9167	0.4451	0.9625	3.39e-51	7abg:F, 7abh:F, 6ff4:7, 6ff7:7, 8i0p:v, 8i0t:v, 7q4o:1, 7q4p:1, 8qo9:G, 6qx9:A2, 8qxd:8, 8r0a:8, 8r0b:8, 8rm5:8, 7vpx:B
3	7dco:v	207	79	0.3095	0.1256	0.3291	1.28e-05	5gm6:I, 5zwm:v, 5zwo:v
4	5nrl:U	196	46	0.2262	0.0969	0.4130	2.91e-04
5	6g90:U	196	46	0.2262	0.0969	0.4130	3.28e-04	7oqb:U, 7oqe:U
6	7mex:A	1737	42	0.1786	0.0086	0.3571	5.7	6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A
7	2crr:A	141	33	0.1071	0.0638	0.2727	5.8
8	7c79:B	793	65	0.2024	0.0214	0.2615	7.1	6agb:B, 6ah3:B, 7c7a:B, 6w6v:B
9	7jtz:B	143	37	0.1310	0.0769	0.2973	7.1	7jtz:A, 7jtz:C, 7jtz:D
10	1deh:A	374	19	0.1071	0.0241	0.4737	8.5	1deh:B, 1hdx:A, 1hdx:B, 1hdy:A, 1hdy:B, 1hdz:A, 1hdz:B, 1hso:A, 1hso:B, 1hsz:A, 1hsz:B, 1ht0:A, 1ht0:B, 1htb:A, 1htb:B, 3hud:A, 3hud:B, 1u3t:A, 1u3t:B, 1u3u:A, 1u3u:B, 1u3v:A, 1u3v:B, 1u3w:A, 1u3w:B
11	6hqd:C	415	30	0.1429	0.0289	0.4000	8.9	6hqd:A, 6hqd:B
12	1r30:B	313	39	0.1786	0.0479	0.3846	9.7	1r30:A

[Back]