BioLiP

>protein
MDDCSGKTDAWTSIKGPKTGGYWLKQTTKTGENECTYVKGTDFKENTKTATYTYGYKDASGKLTKTTGTATAKGSDIVVG
SDTSTVIYTDGKTCDVVKHGGHTELWVHSSKTSGGYNNCCDKKFTETRGSTPANEVYKKCPGMP

The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2x45:A	144	144	1.0000	1.0000	1.0000	1.71e-101	2x45:B, 2x45:C
2	3bu1:A	144	138	0.4861	0.4861	0.5072	3.00e-46
3	3brn:A	153	154	0.4028	0.3791	0.3766	4.58e-25	3brn:B
4	8ovj:c	229	58	0.1319	0.0830	0.3276	0.82	8a3w:c, 8a98:c, 6az3:c, 3jcs:c, 8rxh:Lc, 8rxx:Lc, 5t2a:u
5	5ahm:A	354	69	0.1319	0.0537	0.2754	0.90	5ahm:B
6	5cwe:A	393	106	0.1458	0.0534	0.1981	1.5	5cje:A, 5cwe:B
7	8vby:A	553	38	0.1042	0.0271	0.3947	1.7	9eo4:B, 8y2d:A, 8y2e:A, 8y2f:A, 8y2g:A
8	3d1c:A	358	63	0.1319	0.0531	0.3016	1.7
9	4xyj:A	768	55	0.1319	0.0247	0.3455	2.0	4rh3:A, 4rh3:B, 4rh3:C, 4rh3:D, 4u1r:A, 4u1r:B, 4u1r:C, 4u1r:D, 4wl0:A, 4wl0:B, 4wl0:C, 4wl0:D, 4xyj:B, 4xyj:C, 4xyj:D, 4xyj:E, 4xyj:F, 4xyj:G, 4xyj:H, 4xyk:A, 4xyk:B, 4xyk:C, 4xyk:D, 4xz2:A, 4xz2:B, 4xz2:C, 4xz2:D
10	7lvl:A	296	46	0.1111	0.0541	0.3478	2.8	7lvl:B, 7lvl:C, 7lvl:E, 7lvl:D, 7lvl:F, 7mjf:A, 7mjf:B, 7mjf:C, 7mjf:D, 7mjf:E, 7mjf:F
11	5nns:A	225	41	0.0903	0.0578	0.3171	8.8	5nns:B

[Back]