MARRKVRPRLIAELARRVRALREQRERPRDSVRYALDYETLIRPHSGRKLPLRAWVDVRRESRLLQLLGRLPFFGLGRLV
The query sequence (length=213) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3jd5:j |
213 |
213 |
1.0000 |
1.0000 |
1.0000 |
5.45e-156 |
6neq:j, 6nf8:j |
2 |
5aj3:j |
213 |
212 |
0.8404 |
0.8404 |
0.8443 |
1.07e-120 |
5aj4:Aj, 6gaw:Aj, 6gaz:Aj, 7nqh:Aj, 7nql:Aj, 7nsi:Aj, 7nsj:Aj, 8oin:Aj, 8oip:Aj, 6ydp:Aj, 6ydw:Aj |
3 |
8any:A0 |
215 |
210 |
0.8263 |
0.8186 |
0.8381 |
1.14e-120 |
8csp:0, 8csq:0, 8csr:0, 8css:0, 8cst:0, 8csu:0, 7l08:A0, 8oir:Aj, 8ois:Aj, 7p2e:0, 7pnx:0, 7pny:0, 7pnz:0, 7po0:0, 7po1:0, 7po2:0, 7po3:0, 7qi4:A0, 7qi5:A0, 7qi6:A0, 8qrk:0, 8qrl:0, 8qrm:0, 8qrn:0, 6rw4:0, 6rw5:0, 6vlz:A0, 6vmi:A0, 6zm5:A0, 6zm6:A0 |
4 |
7pnt:0 |
216 |
211 |
0.8075 |
0.7963 |
0.8152 |
4.11e-118 |
7a5f:a6, 7a5g:a6, 7a5i:a6, 7a5k:a6, 3j9m:A0, 8k2a:Sj, 6nu2:A0, 6nu3:A0, 7og4:A0, 7pnu:0, 7pnv:0, 7pnw:0, 8xt0:Sj, 8xt2:Sj, 6zs9:A0, 6zsa:A0, 6zsb:A0, 6zsc:A0, 6zsd:A0, 6zse:A0, 6zsg:A0 |
5 |
7aor:t |
226 |
107 |
0.1268 |
0.1195 |
0.2523 |
0.008 |
|
6 |
7pub:Cj |
227 |
113 |
0.1221 |
0.1145 |
0.2301 |
0.020 |
6hiv:Cj, 6hiw:Cj, 6hiy:Cj, 7pua:Cj, 6sga:Cj, 6sgb:Cj |
7 |
6xyw:By |
76 |
84 |
0.0986 |
0.2763 |
0.2500 |
0.079 |
|
8 |
7pkq:z |
85 |
54 |
0.0939 |
0.2353 |
0.3704 |
0.15 |
|
9 |
7ane:t |
226 |
109 |
0.1362 |
0.1283 |
0.2661 |
0.19 |
|
10 |
4ob3:A |
204 |
67 |
0.1080 |
0.1127 |
0.3433 |
0.40 |
9d6k:A, 8i6n:A, 1ire:A, 4ob0:A, 4ob1:A, 4ob2:A, 1ugp:A, 1ugr:A, 1ugs:A, 3vyh:A, 7w8l:A, 7w8m:A |
11 |
1v29:A |
203 |
61 |
0.0986 |
0.1034 |
0.3443 |
1.5 |
2dpp:A, 3hht:A, 7qom:A, 7qop:A, 7qou:A, 7qov:A, 7qoy:A, 7z0v:A |
12 |
6e85:A |
331 |
28 |
0.0704 |
0.0453 |
0.5357 |
3.2 |
|
13 |
2j8w:A |
128 |
61 |
0.0892 |
0.1484 |
0.3115 |
3.6 |
2j8w:B, 2j9b:A, 2j9b:B, 1jaf:A, 1jaf:B |
14 |
1f76:A |
336 |
34 |
0.0751 |
0.0476 |
0.4706 |
4.2 |
1f76:B, 1f76:D, 1f76:E, 7t5k:A, 7t5k:B, 7t5y:A, 7t5y:B, 7t6c:A, 7t6c:B, 7t6h:A, 7t6h:B |
15 |
8d8p:A |
420 |
81 |
0.1080 |
0.0548 |
0.2840 |
5.5 |
8d8p:B |
16 |
5zb3:A |
280 |
28 |
0.0563 |
0.0429 |
0.4286 |
5.8 |
5zb1:A, 5zb3:B |
17 |
3qxe:A |
201 |
58 |
0.0892 |
0.0945 |
0.3276 |
6.7 |
3qxe:C, 3qxe:E, 3qxe:G, 3qyg:A, 3qyg:C, 3qyg:E, 3qyg:G, 3qyh:A, 3qyh:C, 3qyh:E, 3qyh:G, 3qz5:A, 3qz5:C, 3qz5:E, 3qz5:G, 3qz9:A, 3qz9:C, 3qz9:E, 3qz9:G |
18 |
4cda:A |
127 |
57 |
0.0704 |
0.1181 |
0.2632 |
8.8 |
5agf:A, 4cdv:A, 4cdy:A, 1cgn:A, 1cgo:A, 4cip:A, 4cjg:A, 4cjo:A, 4d4n:A, 4d4x:A, 1e83:A, 1e84:A, 1e85:A, 1e86:A, 5jli:A, 5jp7:A, 5jra:A, 5js5:A, 5jsl:A, 5jt4:A, 5jua:A, 5jve:A, 5nc0:A, 5ngx:A, 4wgy:A, 4wgz:A, 2xl6:A, 2xl8:A, 2xld:A, 2xle:A, 2xlh:A, 2xlm:A, 2xlo:A, 2xlv:A, 2xlw:A, 2xm0:A, 2xm4:A, 2ykz:A, 2yl0:A, 2yl1:A, 2yl3:A, 2yl7:A, 2yld:A, 2ylg:A, 2yli:A, 3zqv:A, 3zqy:A, 3ztm:A, 3ztz:A, 3zwi:A |