LVDERMNGDGTGRPFGVNDPVLGWVLLGVFGTMWAIWFIGQKDLGDFEDADDGLKL
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6kac:W | 56 | 56 | 1.0000 | 1.0000 | 1.0000 | 1.58e-34 | 6kac:w, 6kad:W, 6kad:w |
| 2 | 7pi0:W | 44 | 44 | 0.5714 | 0.7273 | 0.7273 | 1.59e-18 | 7pi0:w, 7pin:w, 7pin:W1, 7pin:w1, 7piw:W, 7piw:w1 |
| 3 | 3jcu:W | 54 | 56 | 0.5179 | 0.5370 | 0.5179 | 8.98e-15 | 3jcu:w, 7oui:W, 7oui:w, 6yp7:W |
| 4 | 8c29:w | 54 | 56 | 0.4821 | 0.5000 | 0.4821 | 3.52e-12 | |
| 5 | 8bd3:W | 60 | 60 | 0.4286 | 0.4000 | 0.4000 | 2.30e-09 | 8bd3:w |
| 6 | 6fht:B | 735 | 24 | 0.2143 | 0.0163 | 0.5000 | 0.34 | 5ajg:A, 8avv:A, 8avv:B, 8avx:A, 8avx:B, 8bor:A, 8bor:B, 8bor:C, 8bor:D, 8c3i:B, 8c3i:A, 5c5k:A, 5c5k:B, 5c5k:C, 5c5k:D, 4cqh:A, 6fht:A, 6ftd:A, 6ftd:B, 4ijg:A, 5k5b:A, 5l8m:A, 5lbr:A, 5mg0:A, 5mg1:A, 5nfx:A, 5nm3:A, 5nm3:B, 5nm3:C, 5nm3:D, 5nwn:A, 5nwn:B, 5nwn:C, 5nwn:D, 4o01:A, 4o01:B, 4o01:C, 4o01:D, 4o0p:A, 4o0p:B, 4o8g:A, 2o9b:A, 2o9c:A, 4q0h:A, 4q0i:A, 4q0j:A, 3s7n:A, 3s7o:A, 3s7p:A, 3s7q:A, 8sgk:A, 8sgk:B, 6t3l:B, 6t3l:A, 6t3u:B, 6t3u:A, 4y3i:A, 4y5f:A, 4z1w:A, 7z9d:A, 7z9e:A, 4zrr:A, 1ztu:A |
| 7 | 8jgj:A | 684 | 16 | 0.1607 | 0.0132 | 0.5625 | 1.2 | 8jgj:B, 8jgk:A, 8jgk:B, 8jgl:A, 8jgl:B, 8jgv:A, 8jgv:B |
| 8 | 8jev:A | 556 | 16 | 0.1607 | 0.0162 | 0.5625 | 1.5 | 8jev:B |
| 9 | 6snh:X | 479 | 31 | 0.2500 | 0.0292 | 0.4516 | 4.6 | 6sni:X |
| 10 | 8qby:L | 659 | 17 | 0.1786 | 0.0152 | 0.5882 | 5.4 | 8qc1:L |
| 11 | 2wyo:C | 496 | 37 | 0.2143 | 0.0242 | 0.3243 | 6.1 | 2wyo:B, 2wyo:D |
umich.edu