LVDDRLAGEGTGKILGINDPSLFWAITIVFTIVWGVFYVSTREIDAASDRENDDDFGLTL
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8bd3:W | 60 | 60 | 1.0000 | 1.0000 | 1.0000 | 7.12e-38 | 8bd3:w |
2 | 6kac:W | 56 | 60 | 0.4000 | 0.4286 | 0.4000 | 2.46e-09 | 6kac:w, 6kad:W, 6kad:w |
3 | 8c29:w | 54 | 60 | 0.4167 | 0.4630 | 0.4167 | 3.72e-08 | |
4 | 7pi0:W | 44 | 44 | 0.3000 | 0.4091 | 0.4091 | 1.84e-07 | 7pi0:w, 7pin:w, 7pin:W1, 7pin:w1, 7piw:W, 7piw:w1 |
5 | 3jcu:W | 54 | 60 | 0.3667 | 0.4074 | 0.3667 | 7.72e-07 | 3jcu:w, 7oui:W, 7oui:w, 6yp7:W |
6 | 6m23:A | 936 | 46 | 0.2333 | 0.0150 | 0.3043 | 0.12 | 6m23:B |
7 | 6m1y:A | 938 | 44 | 0.2500 | 0.0160 | 0.3409 | 0.62 | 6m1y:B, 6m22:A, 6m22:B |
8 | 7air:A | 885 | 28 | 0.1833 | 0.0124 | 0.3929 | 3.2 | 7aip:A, 7aip:B, 7aiq:A, 7aiq:B, 7air:B, 6kkr:A, 6kkr:B, 6kkt:A, 6kkt:B, 6kku:A, 6kku:B, 7tti:A, 7tti:B |
9 | 7d99:A | 891 | 34 | 0.1833 | 0.0123 | 0.3235 | 6.5 | 7d99:B, 6ukn:A |
10 | 7sk8:A | 306 | 38 | 0.1667 | 0.0327 | 0.2632 | 6.5 | 7sk3:A, 7sk4:A, 7sk5:A, 7sk9:A |