BioLiP

>protein
LTPFVLFTGFEPVQVQQYIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEECFRCQKFIDEQN
YILRDAEAEVLFSFSLEESLKRAHVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKLMEHKQNSSLSEI
ILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN

The query sequence (length=205) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3sqd:A	211	205	1.0000	0.9716	1.0000	1.70e-153	3sqd:B
2	3k05:B	200	201	0.3122	0.3200	0.3184	7.46e-30	2azm:A, 2azm:B, 3k05:A
3	3l41:A	214	204	0.2780	0.2664	0.2794	1.60e-22
4	7p0l:A	195	185	0.2390	0.2513	0.2649	2.68e-12	7p0l:B
5	8ir2:B	198	79	0.1122	0.1162	0.2911	4.45e-04	8ir2:A, 8ir4:A, 8ir4:B
6	3al3:A	218	78	0.0976	0.0917	0.2564	0.007	7cmz:A
7	2vxc:A	223	127	0.1463	0.1345	0.2362	0.069
8	6hm5:A	251	55	0.0878	0.0717	0.3273	0.91
9	6rml:B	278	61	0.0927	0.0683	0.3115	1.1
10	7lsy:Y	855	77	0.0878	0.0211	0.2338	3.1	6bkg:A, 4htp:A, 4htp:B, 3w1b:A, 3w1g:A, 3w5o:A, 3w5o:B
11	6iah:A	240	68	0.0927	0.0792	0.2794	3.7
12	8dku:A	395	58	0.0976	0.0506	0.3448	3.8	8dky:A, 8dky:B, 8dn8:A, 8dn8:C, 8dnc:A, 8dne:A, 8dne:C, 8dou:A, 8dou:C, 7k2t:A, 7k2t:C, 6m96:A
13	4a2r:A	247	51	0.0732	0.0607	0.2941	6.0	5an7:A, 4pa8:A, 8xyn:A, 8xyn:B
14	8esq:D	427	115	0.1268	0.0609	0.2261	9.1	8esr:D, 8eth:D, 8eup:D, 8euy:D, 8ev3:D

[Back]