LSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDDRAKEYVSLLKSNDPIGFNIVDVLAWGSIGHI
VAYYILATSSNGYDPSFF
The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7wg5:AG | 99 | 98 | 1.0000 | 0.9899 | 1.0000 | 1.48e-68 | 7dkz:G, 8j6z:G, 8j7a:G, 8j7b:G, 5l8r:G, 7wfd:AG, 7wfe:BG, 7wg5:BG, 6yac:G, 6yez:G, 6zoo:G, 6zxs:G |
2 | 3lw5:G | 95 | 95 | 0.8673 | 0.8947 | 0.8947 | 1.48e-59 | 6igz:G, 2o01:G, 2wsc:G, 2wse:G, 2wsf:G, 4xk8:G, 4xk8:g |
3 | 8wgh:G | 98 | 98 | 0.8776 | 0.8776 | 0.8776 | 1.98e-59 | |
4 | 5zji:G | 97 | 98 | 0.8367 | 0.8454 | 0.8367 | 4.19e-58 | |
5 | 8bcv:G | 94 | 95 | 0.8265 | 0.8617 | 0.8526 | 3.97e-56 | |
6 | 4y28:G | 91 | 94 | 0.7959 | 0.8571 | 0.8298 | 1.92e-51 | |
7 | 6l35:G | 98 | 94 | 0.6327 | 0.6327 | 0.6596 | 6.21e-44 | 8htu:G, 7ksq:G, 7kux:G, 7xqp:G |
8 | 4rku:G | 84 | 89 | 0.7143 | 0.8333 | 0.7865 | 3.97e-42 | |
9 | 7a4p:G | 99 | 95 | 0.5306 | 0.5253 | 0.5474 | 5.44e-34 | 6zzx:G, 6zzy:G |
10 | 7yca:G | 95 | 87 | 0.4796 | 0.4947 | 0.5402 | 6.06e-32 | |
11 | 7zq9:G | 95 | 92 | 0.3980 | 0.4105 | 0.4239 | 2.26e-18 | 7d0j:G, 7dz7:G, 7dz8:G, 8h2u:G, 7zqd:G, 7zqd:G2 |
12 | 7zqc:G | 80 | 90 | 0.3878 | 0.4750 | 0.4222 | 1.30e-16 | 7bgi:G, 7blx:G, 6jo5:G, 6jo6:G |
13 | 8cmo:G | 93 | 93 | 0.3265 | 0.3441 | 0.3441 | 1.27e-14 | |
14 | 6ijo:G | 70 | 90 | 0.3367 | 0.4714 | 0.3667 | 1.65e-13 | 7r3k:G |
15 | 6sl5:G | 101 | 94 | 0.3571 | 0.3465 | 0.3723 | 9.28e-09 | |
16 | 7a4p:K | 86 | 84 | 0.3163 | 0.3605 | 0.3690 | 4.07e-06 | 6zzx:K, 6zzy:K |
17 | 8j6z:K | 84 | 85 | 0.2653 | 0.3095 | 0.3059 | 7.83e-06 | 7dkz:K, 8j7b:K, 5l8r:K, 4rku:K, 6yac:K, 6yez:K, 6zoo:K, 6zxs:K |
18 | 6igz:K | 80 | 86 | 0.3061 | 0.3750 | 0.3488 | 1.46e-05 | |
19 | 8bcv:K | 88 | 85 | 0.2755 | 0.3068 | 0.3176 | 3.08e-05 | 7ew6:K, 7ewk:K, 7f9o:K, 7f9o:n, 2wse:K, 5zji:K |
20 | 8htu:K | 81 | 86 | 0.2551 | 0.3086 | 0.2907 | 4.39e-05 | 7ksq:K, 7kux:K, 6l35:K, 7xqp:K |
21 | 8cmo:K | 89 | 29 | 0.1633 | 0.1798 | 0.5517 | 2.85e-04 | |
22 | 8wgh:K | 83 | 86 | 0.2551 | 0.3012 | 0.2907 | 4.26e-04 | |
23 | 7wfd:AK | 65 | 29 | 0.1224 | 0.1846 | 0.4138 | 5.59e-04 | 7wfe:BK, 7wg5:AK, 7wg5:BK |
24 | 7dz7:K | 86 | 20 | 0.1531 | 0.1744 | 0.7500 | 7.01e-04 | 7bgi:K, 7blx:K, 7d0j:K, 7dz8:K, 6ijj:K, 6ijo:K, 7r3k:K, 7zq9:K, 7zqc:K, 7zqd:K, 7zqd:K2 |
25 | 8j7a:K | 56 | 25 | 0.1122 | 0.1964 | 0.4400 | 0.010 | |
26 | 6sl5:K | 84 | 78 | 0.2551 | 0.2976 | 0.3205 | 0.058 | |
27 | 7yca:K | 87 | 50 | 0.2143 | 0.2414 | 0.4200 | 0.11 | |
28 | 4xk8:k | 46 | 17 | 0.0918 | 0.1957 | 0.5294 | 2.7 | 4xk8:K |
29 | 8wm6:K | 69 | 31 | 0.1429 | 0.2029 | 0.4516 | 3.0 | 8wmj:K, 8wmv:K, 8wmw:K |
30 | 5xxb:K | 199 | 35 | 0.1327 | 0.0653 | 0.3714 | 3.5 | |
31 | 8b4l:C | 311 | 18 | 0.0918 | 0.0289 | 0.5000 | 4.1 | 8b4l:E, 8b4l:A, 8b4l:B, 8b4l:D, 8b4l:F, 8b4m:B, 8b4m:D, 8b4m:E, 8b4m:F |
32 | 1nt4:A | 391 | 30 | 0.1122 | 0.0281 | 0.3667 | 4.1 | 1nt4:B, 6rmr:A |
33 | 4a42:A | 127 | 14 | 0.1020 | 0.0787 | 0.7143 | 5.2 | 4a42:B |
34 | 5odn:D | 106 | 28 | 0.1020 | 0.0943 | 0.3571 | 6.4 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
35 | 3ntl:A | 388 | 29 | 0.1122 | 0.0284 | 0.3793 | 6.5 | 3ntl:B |