BioLiP

>protein
LSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAYRVFTQDNFFSTKAVIAPEVVA
RQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQERGGHISPLAAYNEQTDRFLI
MDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVSK

The query sequence (length=200) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6tho:A	220	211	1.0000	0.9091	0.9479	2.08e-145	2btw:A, 2btw:B, 2bu3:A, 2bu3:B, 6th5:A, 6th5:B, 6tho:B, 6tjl:A, 6tjl:B
2	6qgh:A	154	77	0.1100	0.1429	0.2857	0.20	6qg8:A, 6qgg:A, 6qgj:A, 6qgk:A, 7yb7:A, 7yb7:B
3	6muk:A	363	28	0.0550	0.0303	0.3929	2.3
4	1ebd:A	455	52	0.0900	0.0396	0.3462	2.3	1ebd:B
5	5wxu:B	400	67	0.1150	0.0575	0.3433	3.0	5wxu:A, 5wxu:D, 5wxu:F, 5wxu:C, 5wxu:E
6	6w2l:B	195	102	0.1200	0.1231	0.2353	3.1	7pb1:B
7	5og1:A	819	81	0.1150	0.0281	0.2840	6.2	5ofo:C, 5ofo:F, 5ofo:E, 5ofo:D, 5ofo:B, 5ofo:A, 5og1:E, 6rn2:A, 6rn2:B, 6rn2:C, 6rn2:D, 6rn2:F, 6rn2:E, 6rn3:A, 6rn3:B, 6rn3:C, 6rn3:D, 6rn3:E, 6rn4:B, 6rn4:C, 6rn4:D, 6rn4:E
8	5j9q:E	293	103	0.1200	0.0819	0.2330	6.3	1fy7:A, 5j9q:I, 5j9q:A, 5j9w:E, 5j9w:I, 1mj9:A, 1mja:A, 1mjb:A, 3to6:A, 3to7:A, 3to9:A, 7vvu:P, 7vvz:P
9	7wao:A	502	52	0.0850	0.0339	0.3269	8.7	7waj:A, 7wak:A, 7wal:A

[Back]