LSDIYLELKKGYADSLLYSDLSLLVNIMEYEKDIDVMSIQSLVAGYEKSDTPTITCGIIVYNESKRIKKCLNSVKDDFNE
IIVLDSYSTDDTVDIIKCDFPDVEIKYEKWKNDFSYARNKIIEYATSEWIYFIDADNLYSKENKGKIAKVARVLEFFSID
CVVSPYIEEYTGHLYSDTRRMFRLNGKVKFHGKVHEEPMNYNHSLPFNFIVNLKVYHNGYNPSENNIKSKTRRNINLTEE
MLRLEPENPKWLFFFGRELHLLDKDEEAIDYLKKSINNYKKFNDQRHFIDALVLLCTLLLQRNNYVDLTLYLDILETEYP
RCVDVDYFRSAIL
The query sequence (length=333) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7msn:A | 417 | 333 | 0.9880 | 0.7890 | 0.9880 | 0.0 | 7msn:B, 7msp:A, 7msp:B |
2 | 7msk:A | 421 | 339 | 0.4565 | 0.3610 | 0.4484 | 2.22e-101 | 7msk:B |
3 | 6yv8:A | 346 | 127 | 0.0991 | 0.0954 | 0.2598 | 7.00e-04 | 6yv8:B, 6yv9:A, 6yv9:B |
4 | 5tze:C | 349 | 93 | 0.0841 | 0.0802 | 0.3011 | 0.003 | 5tze:E, 5tzj:C, 5tzj:A, 5tzk:C |
5 | 1h7q:A | 240 | 157 | 0.1051 | 0.1458 | 0.2229 | 0.029 | 1h7l:A, 1qgq:A, 1qgs:A |
6 | 8ui7:A | 643 | 105 | 0.0661 | 0.0342 | 0.2095 | 0.31 | 8ui8:A, 8ui9:A, 8uii:A |
7 | 6h4f:B | 318 | 87 | 0.0691 | 0.0723 | 0.2644 | 0.38 | 6h1j:B, 6h21:A, 6h21:B, 6h21:C, 6h2n:A, 6h2n:B, 6h2n:C, 6h4f:C, 6h4f:F, 6h4f:O, 6h4f:P, 6h4f:E, 6h4f:G, 6h4f:Q, 6h4f:A, 6h4f:D, 6h4f:H, 6h4f:I, 6h4m:B, 6h4m:C, 6h4m:F, 6h4m:O, 6h4m:P, 6h4m:E, 6h4m:G, 6h4m:Q, 6h4m:A, 6h4m:D, 6h4m:H, 6h4m:I, 6hnq:B, 6hnq:C, 6hnq:F, 6hnq:O, 6hnq:P, 6hnq:E, 6hnq:G, 6hnq:Q, 6hnq:A, 6hnq:D, 6hnq:H, 6hnq:I |
8 | 5x6b:J | 377 | 77 | 0.0631 | 0.0557 | 0.2727 | 0.76 | 5x6b:I |
9 | 2z86:C | 603 | 94 | 0.0841 | 0.0464 | 0.2979 | 1.1 | 2z86:A, 2z86:B, 2z86:D, 2z87:A, 2z87:B |
10 | 4dec:A | 284 | 98 | 0.0811 | 0.0951 | 0.2755 | 2.0 | 4de7:A, 3e25:A, 5jsx:A, 5jt0:A, 5juc:A, 5jud:A, 4y6n:A, 4y6u:A, 4y7f:A, 4y7g:A, 4y9x:A |
11 | 3j5s:D | 554 | 69 | 0.0691 | 0.0415 | 0.3333 | 4.7 | |
12 | 6t46:G | 365 | 50 | 0.0390 | 0.0356 | 0.2600 | 6.7 | 6t46:A, 6t46:C, 6t46:E |
13 | 3top:A | 890 | 109 | 0.0811 | 0.0303 | 0.2477 | 7.3 | 3top:B |