LSAIIPRSSWLAQKPMDEPLPLQLPVKYVVILHTATESSEKRAINVRLIRDMQSFHIESRGWNDIAYNFLVGCDGNIYEG
RGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNLLARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQT
WPHFYNIEEE
The query sequence (length=170) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2cb3:C | 173 | 170 | 1.0000 | 0.9827 | 1.0000 | 1.15e-128 | 2cb3:A, 2cb3:B, 2cb3:D |
2 | 2f2l:X | 166 | 142 | 0.4412 | 0.4518 | 0.5282 | 8.72e-49 | |
3 | 2xz4:A | 165 | 161 | 0.4118 | 0.4242 | 0.4348 | 2.82e-46 | |
4 | 2aph:A | 165 | 161 | 0.4118 | 0.4242 | 0.4348 | 8.06e-44 | 2aph:B, 1sk4:A, 1twq:A |
5 | 1oht:A | 173 | 167 | 0.4176 | 0.4104 | 0.4251 | 2.65e-41 | 7nsx:AAA, 7nsz:AAA, 7nt0:AAA, 7nt0:BBB |
6 | 3cg9:A | 171 | 165 | 0.4235 | 0.4211 | 0.4364 | 1.70e-40 | 6a89:B, 6a89:A, 6a89:D, 3cg9:B, 3cxa:A, 3cxa:B, 7dy5:C, 5e0b:C, 4fnn:A, 4fnn:B, 4fnn:D, 4gf9:D, 4gf9:C, 3ng4:C, 3ng4:D, 3nno:D, 3nw3:D, 3o4k:A, 3o4k:C, 3o4k:D, 3ogx:C, 3ogx:A, 4opp:A, 4opp:B, 4opp:D, 4opp:C, 4orv:D, 4oug:C, 4oug:D, 4q8s:A, 4q8s:C, 4q8s:D, 4q9e:D, 3qv4:C, 3rt4:C, 3rt4:D, 3t2v:B, 3t2v:D, 3t39:D, 3tru:D, 3usx:B, 7xfw:C, 7xfx:C, 7xfy:C, 7xfy:D, 7xu8:A, 7xu8:B |
7 | 2eax:C | 164 | 162 | 0.4059 | 0.4207 | 0.4259 | 7.39e-39 | |
8 | 4z8i:A | 224 | 161 | 0.3824 | 0.2902 | 0.4037 | 1.10e-38 | |
9 | 2f2l:A | 167 | 165 | 0.3882 | 0.3952 | 0.4000 | 1.75e-35 | |
10 | 6srt:A | 152 | 103 | 0.2118 | 0.2368 | 0.3495 | 7.47e-10 | 6ssc:A |
11 | 6fhg:A | 156 | 141 | 0.2412 | 0.2628 | 0.2908 | 7.11e-09 | 6fhg:B |
12 | 1lba:A | 146 | 67 | 0.1471 | 0.1712 | 0.3731 | 1.79e-08 | |
13 | 6su5:A | 154 | 129 | 0.2118 | 0.2338 | 0.2791 | 9.96e-07 | |
14 | 7f5i:A | 153 | 53 | 0.1353 | 0.1503 | 0.4340 | 6.10e-06 | |
15 | 8hnw:A | 809 | 60 | 0.1235 | 0.0260 | 0.3500 | 0.94 | |
16 | 6kr4:C | 575 | 78 | 0.1353 | 0.0400 | 0.2949 | 1.7 | |
17 | 2gsy:E | 433 | 84 | 0.1353 | 0.0531 | 0.2738 | 2.2 | 2df7:A, 2df7:F, 2df7:B, 2df7:C, 2df7:E, 2df7:L, 2df7:G, 2df7:K, 2df7:M, 2df7:H, 2df7:N, 2df7:O, 2df7:I, 2df7:J, 2df7:Q, 2df7:P, 2df7:R, 2df7:S, 2df7:T, 2gsy:A, 2gsy:B, 2gsy:C, 2gsy:J, 2gsy:D, 2gsy:F, 2gsy:I, 2gsy:K, 2gsy:G, 2gsy:H, 2gsy:N, 2gsy:L, 2gsy:M, 2gsy:R, 2gsy:O, 2gsy:P, 2gsy:Q, 2gsy:S, 2gsy:T |