BioLiP

>protein
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPG
TPGDLLELQICPLNGYCE

The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1bcp:F	98	98	1.0000	1.0000	1.0000	3.09e-71	1bcp:L
2	1bcp:C	196	77	0.1939	0.0969	0.2468	2.2	1bcp:I, 1pto:C, 1pto:I
3	1ao7:E	209	52	0.1327	0.0622	0.2500	2.7
4	7fjd:n	287	52	0.1327	0.0453	0.2500	3.7	2ak4:E, 2ak4:J, 2ak4:P, 2ak4:U, 1bd2:E, 6bj3:H, 6bj8:H, 2bnq:E, 2bnr:E, 3d39:E, 3d3v:E, 2f53:E, 2f54:E, 2f54:L, 7fje:n, 4ftv:E, 4g8g:E, 2gj6:E, 3gsn:B, 3h9s:E, 3kxf:E, 3kxf:H, 3kxf:P, 3kxf:O, 5men:E, 4mnq:E, 2p5e:E, 2p5w:E, 3pwp:E, 2pye:E, 6q3s:E, 7q9b:EEE, 7q9b:JJJ, 3qfj:E, 1qrn:E, 1qse:E, 6rpb:E, 6rpb:J, 6rpb:O, 6rpb:T, 8shi:H, 8shi:J, 7t2b:E, 7t2b:J, 7t2b:O, 7t2b:T
5	3iup:A	376	42	0.1531	0.0399	0.3571	3.7	3iup:B
6	5m7n:B	428	20	0.1224	0.0280	0.6000	3.8
7	5m7o:A	448	20	0.1224	0.0268	0.6000	3.8	4d6y:A, 4d6y:B, 5m7n:A, 5m7o:B, 5m7p:A, 5m7p:B
8	8urw:Z	1235	32	0.1122	0.0089	0.3438	5.2	8syi:Z
9	1pto:B	196	77	0.1735	0.0867	0.2208	5.6
10	4ig6:A	223	33	0.1429	0.0628	0.4242	6.6
11	5oet:B	420	21	0.0918	0.0214	0.4286	7.1
12	6z1p:As	236	34	0.1327	0.0551	0.3824	8.4
13	5wyr:B	248	24	0.1122	0.0444	0.4583	9.6	6afk:A, 6afk:B, 6jki:A, 6jki:B, 6joe:A, 6joe:B, 5wyq:A, 5wyq:B, 5wyr:A, 5zhm:A, 5zhm:B, 5zhn:A, 5zhn:B

[Back]