LPPITPQELESMSPQEQRAALGDRLFLKVYEIAPELAPKITGMFLEMKPKEAYELLNDQKRLEERVTEALCVLKAHQT
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6h7b:A | 78 | 78 | 1.0000 | 1.0000 | 1.0000 | 1.94e-52 | 6h7b:C |
2 | 1jgn:A | 98 | 75 | 0.4359 | 0.3469 | 0.4533 | 6.52e-15 | 7bn3:C, 7bn3:A, 7bn3:B, 1jh4:A, 3ktp:A, 3ktr:A, 3kui:A, 3kuj:A, 3kus:A, 3kus:B, 3kut:A, 3kut:B, 3pkn:A, 3pth:A, 2rqg:B, 2rqh:B, 8smo:A, 8smo:C, 8smo:E, 8smo:G, 8smo:I, 8smo:K, 8smo:M, 8smo:O, 2x04:A, 2x04:B |
3 | 3ntw:A | 61 | 59 | 0.3205 | 0.4098 | 0.4237 | 8.73e-08 | 3ntw:C |
4 | 2r50:C | 147 | 43 | 0.2692 | 0.1429 | 0.4884 | 0.021 | 2r50:A, 2r50:B, 2r50:D |
5 | 7z1u:A | 147 | 20 | 0.1410 | 0.0748 | 0.5500 | 0.45 | 7z1u:B, 7zos:A |
6 | 2oif:G | 154 | 20 | 0.1410 | 0.0714 | 0.5500 | 0.58 | 2oif:A, 2oif:B, 2oif:C, 2oif:D, 2oif:E, 2oif:F, 2oif:H |
7 | 3zhw:A | 154 | 20 | 0.1282 | 0.0649 | 0.5000 | 0.93 | 3zhw:B |
8 | 3qqq:A | 150 | 20 | 0.1282 | 0.0667 | 0.5000 | 1.2 | 3qqq:B, 3qqr:A, 3qqr:B |
9 | 2agw:B | 361 | 66 | 0.2308 | 0.0499 | 0.2727 | 3.3 | 2agw:A, 2agx:B, 2agx:A, 2agy:B, 2agz:B, 2agz:A, 2ah0:B, 2ah0:A, 2hj4:B, 2hj4:A, 2hjb:B, 2hjb:A, 2hkr:B, 2hkr:A, 2iuq:A, 2iuq:B, 2oiz:A, 2ojy:A, 2q7q:B, 2q7q:A |
10 | 5b43:A | 1272 | 23 | 0.1154 | 0.0071 | 0.3913 | 3.9 | |
11 | 8sfn:A | 1302 | 23 | 0.1154 | 0.0069 | 0.3913 | 3.9 | 8sfh:A, 8sfl:A, 5xh6:A, 5xh7:A |
12 | 5kk5:A | 1201 | 23 | 0.1154 | 0.0075 | 0.3913 | 3.9 | |
13 | 8sfo:A | 1240 | 23 | 0.1154 | 0.0073 | 0.3913 | 4.0 | 8sfi:A, 8sfp:A, 8sfq:A, 8sfr:A |
14 | 2dpm:A | 258 | 42 | 0.1538 | 0.0465 | 0.2857 | 6.7 | |
15 | 6kdy:D | 342 | 20 | 0.1538 | 0.0351 | 0.6000 | 7.3 | 8grd:B, 8gru:B, 8gru:D, 6kdy:B, 6kdy:F |
16 | 6f6t:B | 677 | 29 | 0.1538 | 0.0177 | 0.4138 | 8.5 | 6f6t:A, 6hqf:A, 6hqf:B |
17 | 6rgs:B | 626 | 29 | 0.1538 | 0.0192 | 0.4138 | 8.9 |