LPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDES
ADCHLWYAVLCGQLAESIQRRIQSGFSFKEHVDKAIALQPENPMAHFLLGRWCYQVSHLSWLEKKTATALLSPLSATVED
ALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLALELPDVTKEDLAIQKDLEELEVIL
The query sequence (length=227) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7cc7:A | 227 | 227 | 1.0000 | 1.0000 | 1.0000 | 8.59e-168 | |
2 | 4v6w:CJ | 182 | 65 | 0.0837 | 0.1044 | 0.2923 | 1.4 | 6xu6:CJ, 6xu7:CJ, 6xu8:CJ |
3 | 4ba0:A | 781 | 39 | 0.0661 | 0.0192 | 0.3846 | 1.7 | 4b9y:A, 4b9z:A, 5i23:A, 5i24:A, 5npb:A, 5npc:A, 5npd:A, 5npe:A, 7p4c:AAA, 7p4d:AAA, 8rw3:C, 8rw3:A, 8rw3:B |
4 | 8jze:l | 250 | 49 | 0.0661 | 0.0600 | 0.3061 | 1.9 | 8jzf:l |
5 | 7jil:x | 78 | 39 | 0.0441 | 0.1282 | 0.2564 | 3.6 | |
6 | 7eip:A | 966 | 84 | 0.0837 | 0.0197 | 0.2262 | 3.6 | 7eiq:A, 7eir:A, 7eis:A, 7yke:A |
7 | 6z2p:A | 356 | 63 | 0.0749 | 0.0478 | 0.2698 | 3.7 | 6z2d:A, 6z2o:A, 6z2q:A |
8 | 1xje:A | 627 | 47 | 0.0617 | 0.0223 | 0.2979 | 6.1 | 3o0n:B, 3o0o:A, 3o0o:B, 3o0q:A, 3o0q:B, 1xje:B, 1xjf:A, 1xjf:B, 1xjg:A, 1xjg:B, 1xjj:A, 1xjj:B, 1xjk:A, 1xjk:B, 1xjm:A, 1xjn:A, 1xjn:B, 1xjn:C, 1xjn:D |
9 | 3o0n:A | 607 | 47 | 0.0617 | 0.0231 | 0.2979 | 7.1 | 1xjm:B |