LNHLYMAVVADHSKRPHHHGQLDGVEAVQLNNPTCGDVISLTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKE
EALALADIFSEMVQGQENPAQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKR
The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1su0:B | 136 | 136 | 1.0000 | 1.0000 | 1.0000 | 3.43e-100 | |
2 | 2azh:A | 147 | 136 | 0.5074 | 0.4694 | 0.5074 | 7.14e-47 | 6jzv:A, 6jzv:B, 6jzv:C, 6jzv:D, 6jzw:A, 6jzw:B, 6jzw:C, 6jzw:D, 1xjs:A, 5xt5:D, 5xt5:C, 5xt6:D, 5xt6:C |
3 | 2qq4:A | 138 | 136 | 0.4485 | 0.4420 | 0.4485 | 1.15e-33 | 2qq4:B, 2qq4:C, 2qq4:D, 2qq4:E, 2qq4:F, 2qq4:G, 2qq4:H, 2qq4:I, 2qq4:J |
4 | 8odq:A | 150 | 139 | 0.4118 | 0.3733 | 0.4029 | 1.12e-31 | 8odq:C |
5 | 6a6f:A | 136 | 133 | 0.3603 | 0.3603 | 0.3684 | 1.96e-25 | 6a6f:B, 6a6g:C, 6a6g:D |
6 | 4eb5:C | 138 | 131 | 0.3456 | 0.3406 | 0.3588 | 7.54e-18 | 4eb5:D, 4eb7:C |
7 | 7cnv:A | 132 | 131 | 0.3235 | 0.3333 | 0.3359 | 2.50e-15 | 7c8m:A, 7c8m:C, 7c8n:A, 7c8o:D, 7c8o:B, 7cnv:B, 7cnv:C, 7cnv:D, 7cnv:E, 7cnv:F |
8 | 1r9p:A | 134 | 135 | 0.3529 | 0.3582 | 0.3556 | 2.08e-14 | |
9 | 2z7e:B | 140 | 136 | 0.3529 | 0.3429 | 0.3529 | 1.92e-13 | |
10 | 5wlw:D | 128 | 133 | 0.3309 | 0.3516 | 0.3383 | 1.76e-11 | |
11 | 1wfz:A | 130 | 126 | 0.3088 | 0.3231 | 0.3333 | 5.41e-09 | 6nzu:D, 6nzu:H, 8pk8:D, 8pk9:D, 8pka:D, 5wlw:H |
12 | 6rtg:A | 503 | 69 | 0.1618 | 0.0437 | 0.3188 | 3.7 | |
13 | 7am2:Aj | 342 | 24 | 0.0882 | 0.0351 | 0.5000 | 5.8 | 7aih:Aj, 7ane:Aj |