LKDLKKVKVTQPQSSIVLKPVPIGEPIIWSRVQHLYWRALHVIEDFPWMGPSQTSEQFDIMLSVKEEIQKNANAAGALKD
RLLEDFEAHIKRRDWMQRRVHYFANGGPGYQTFASERHTLEQQGVWKAGTPIPFPKSDYNDDGPVEKGPYY
The query sequence (length=151) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8iuf:B9 | 151 | 151 | 1.0000 | 1.0000 | 1.0000 | 2.06e-112 | 8j9h:B9, 8j9i:B9, 8j9j:B9 |
2 | 1i52:A | 225 | 49 | 0.1126 | 0.0756 | 0.3469 | 1.8 | 1h3m:A, 1h3m:B, 1ini:A |
3 | 7nhk:g | 97 | 52 | 0.1126 | 0.1753 | 0.3269 | 2.6 | 6o8w:f, 6o8x:f, 6o8y:f, 6o8z:f, 6o90:f, 7p7q:g, 7p7r:g, 7p7s:g, 7p7t:g, 7p7u:g, 6w6p:f, 6wub:f |
4 | 8d40:B | 427 | 56 | 0.0927 | 0.0328 | 0.2500 | 4.5 | 8d40:A |
5 | 8cja:B | 731 | 30 | 0.0795 | 0.0164 | 0.4000 | 5.2 | 8cjb:B, 8cjc:B, 8cmw:B, 7nyp:A, 7nyp:B, 7nys:A, 7nys:B, 7nz5:A, 7nz5:B, 7o0d:A, 1ru3:A, 7zkj:B, 7zkk:B, 7zkv:B |
6 | 2bko:A | 190 | 35 | 0.0861 | 0.0684 | 0.3714 | 7.1 | |
7 | 6fh2:A | 353 | 74 | 0.1523 | 0.0652 | 0.3108 | 7.5 | 6fh3:A, 6fh3:B |
8 | 3e1z:A | 109 | 16 | 0.0596 | 0.0826 | 0.5625 | 8.2 |