LKASSLRALKLMDLSTLNGDYTDEKVIALCHQAKTPVGNTAAISIYPRSIPIARKTLKEQGTPEIRIATVTNFPHGNDDI
EIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIESGELKDEALIRKASEISIKAGA
DFIKTSTGLVAVNATPESARIMMEVIRDMGVEKSVGFKVTGGARTAEDAQKYLAIADELFGADWADARHYRFGASGLLAS
LLKALGH
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jcj:A | 252 | 247 | 0.9433 | 0.9246 | 0.9433 | 4.41e-152 | 5eky:A, 5el1:A, 5emu:A, 8for:A, 8for:B, 8for:C, 8for:D, 8for:E, 8for:F, 1jcj:B, 1jcl:A, 1jcl:B, 7p76:A, 7p76:B, 7p76:C, 7p76:D, 7p76:E, 7p76:F, 7p76:G, 7p76:H, 7p76:I, 7p76:J, 7p76:K, 7p76:L, 3q2d:A, 3q2d:B, 6z9i:B |
2 | 3ngj:D | 222 | 204 | 0.2672 | 0.2973 | 0.3235 | 9.80e-21 | 3ngj:A, 3ngj:B, 3ngj:C |
3 | 1ub3:A | 211 | 149 | 0.2186 | 0.2559 | 0.3624 | 2.15e-14 | 1ub3:B, 1ub3:C, 1ub3:D |
4 | 3qyq:A | 273 | 216 | 0.2470 | 0.2234 | 0.2824 | 4.41e-14 | 3qyq:B |
5 | 3i4l:A | 524 | 52 | 0.0769 | 0.0363 | 0.3654 | 0.10 | 3i73:A |
6 | 5lst:A | 617 | 46 | 0.0648 | 0.0259 | 0.3478 | 0.57 | |
7 | 8onj:A | 277 | 63 | 0.0810 | 0.0722 | 0.3175 | 0.86 | 8ahr:A, 8ahr:B, 8aie:A, 8aie:B, 8ayj:A, 8ayj:B, 8ayk:A, 8ayk:B, 8onj:B, 8onl:A, 8onl:B, 8onm:A, 8onm:B, 8onn:A, 8onn:B, 8onn:C, 8onn:D |
8 | 5xhu:A | 329 | 31 | 0.0526 | 0.0395 | 0.4194 | 2.4 | |
9 | 1rm6:A | 761 | 47 | 0.0648 | 0.0210 | 0.3404 | 4.5 | 1rm6:D, 1sb3:A, 1sb3:D |
10 | 3al0:C | 564 | 98 | 0.1053 | 0.0461 | 0.2653 | 5.3 | 3afh:A, 3akz:B, 3akz:D, 3akz:C, 3akz:A |
11 | 4hnn:F | 320 | 62 | 0.0729 | 0.0563 | 0.2903 | 5.7 | 4hnn:A, 4hnn:B, 4hnn:C, 4hnn:D, 4hnn:E, 4hnn:G, 4hnn:H |
12 | 5ey5:A | 261 | 70 | 0.0810 | 0.0766 | 0.2857 | 6.9 | 5ey5:C |
13 | 3d8n:A | 250 | 77 | 0.0850 | 0.0840 | 0.2727 | 8.1 | |
14 | 6xfr:B | 216 | 51 | 0.0607 | 0.0694 | 0.2941 | 8.9 | 6xfr:A |