BioLiP

>protein
LIHLDPVPSFEDRHEIKPWLQKIFYPQGIDIVIERSDSSKVTFKCRSVACPFRIRAAYSVRLQKWNVVVMNNIHSHELRF
DLITKTDDYKKFKENLRQKNDEKAIKTFDELEYKASLNLPL

The query sequence (length=121) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4lmg:B	121	121	1.0000	1.0000	1.0000	7.21e-88	4lmg:A, 4lmg:C, 4lmg:D
2	6jgz:B	3485	69	0.1488	0.0052	0.2609	1.3	6jg3:A, 6jg3:B, 6jg3:C, 6jg3:D, 6jgz:D, 6jgz:F, 6jgz:H, 6jh6:B, 6jh6:D, 6jh6:F, 6jh6:H, 6jhn:A, 6jhn:C, 6jhn:E, 6jhn:G, 6ji0:A, 6ji0:C, 6ji0:E, 6ji0:G, 6jrr:A, 6jrr:C, 6jrr:E, 6jrr:G
3	6jiy:A	3521	69	0.1488	0.0051	0.2609	1.3	6ji8:A, 6ji8:D, 6ji8:G, 6ji8:J, 6jii:B, 6jii:E, 6jii:H, 6jii:K, 6jiu:A, 6jiu:D, 6jiu:G, 6jiu:J, 6jiy:D, 6jiy:G, 6jiy:J, 6jv2:A, 6jv2:C, 6jv2:E, 6jv2:G
4	6jrs:A	3488	69	0.1488	0.0052	0.2609	1.3	6jrs:D, 6jrs:G, 6jrs:J
5	8sk0:B	330	35	0.0909	0.0333	0.3143	1.4	8shh:A, 8shh:B, 8sk0:A
6	5go9:A	3423	69	0.1488	0.0053	0.2609	1.4	5go9:B, 5go9:C, 5go9:D, 5goa:A, 5goa:B, 5goa:C, 5goa:D
7	1jba:A	189	74	0.1736	0.1111	0.2838	1.6
8	3uq6:A	345	43	0.1240	0.0435	0.3488	2.9	4dc3:A, 4dc3:B, 3uq6:B, 3uq9:A, 3uq9:B, 3vaq:A, 3vaq:B, 3vas:A, 3vas:B
9	5fjw:A	263	39	0.1322	0.0608	0.4103	4.1	5fjw:B, 5fjw:F, 5fjw:C, 5fjw:D, 5fjw:G, 5fjw:E, 5fjw:H, 5fjx:B, 5fjx:A, 5fjz:A, 5fjz:C, 5fjz:B, 5fjz:D, 5fk0:B
10	3jb9:B	904	68	0.1322	0.0177	0.2353	6.7
11	5lm1:A	339	37	0.0992	0.0354	0.3243	7.0

[Back]