LDPKLCYLLDGILFIYGVILTALFLRVKFS
The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7phr:Z | 34 | 29 | 0.9667 | 0.8529 | 1.0000 | 3.78e-14 | 9ci8:b, 8es7:Y, 8es8:Y, 8es9:Y, 7fjd:a, 7fje:a, 7fjf:a, 8jc0:a, 8jcb:A, 8jcb:a, 8wy0:b, 8wyi:a |
2 | 3pbk:A | 555 | 22 | 0.3333 | 0.0180 | 0.4545 | 4.2 | 3pbk:B |
3 | 9cpo:A | 930 | 19 | 0.3333 | 0.0108 | 0.5263 | 4.4 | |
4 | 6dsz:B | 1072 | 27 | 0.4333 | 0.0121 | 0.4815 | 6.8 | |
5 | 7dlk:A | 363 | 15 | 0.3000 | 0.0248 | 0.6000 | 7.9 | 7dlk:B, 7dlk:C, 7dlk:D, 7dlk:E, 7dlk:F, 7e5q:A, 7e5q:B, 6kmm:A, 6kmm:B, 6kmm:C, 6kmm:D, 6kmm:E, 6kmm:F, 6kmn:A, 6kmn:B, 6kmn:C, 6kmn:D, 7pkx:A, 7pkx:B, 7pl0:A, 7pl0:B, 7pl0:C, 7pl0:D |
6 | 7eto:a | 1297 | 24 | 0.3000 | 0.0069 | 0.3750 | 8.7 | 7et3:a, 7etj:a |
7 | 7xlq:A | 1319 | 27 | 0.3000 | 0.0068 | 0.3333 | 8.8 | 8epl:A, 7yg5:A |
8 | 8hey:D | 1270 | 24 | 0.3000 | 0.0071 | 0.3750 | 9.2 |